PDB entry 1f23

View 1f23 on RCSB PDB site
Description: contribution of a buried hydrogen bond to hiv-1 envelope glycoprotein structure and function
Class: viral protein
Keywords: HIV-1 envelope protein, gp41, membrane fusion, HIV-1 entry, Viral protein
Deposited on 2000-05-23, released 2001-06-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-08-16, with a file datestamp of 2017-08-11.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: transmembrane glycoprotein
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q89797 (42-End)
      • engineered (27)
      • insertion (36-41)
    Domains in SCOPe 2.07: d1f23a_
  • Chain 'B':
    Compound: transmembrane glycoprotein
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q89797 (42-75)
      • engineered (27)
      • insertion (39-41)
    Domains in SCOPe 2.07: d1f23b_
  • Chain 'C':
    Compound: transmembrane glycoprotein
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q89797 (42-End)
      • engineered (27)
      • insertion (39-41)
    Domains in SCOPe 2.07: d1f23c_
  • Chain 'D':
    Compound: transmembrane glycoprotein
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q89797 (42-End)
      • engineered (27)
      • insertion (36-41)
    Domains in SCOPe 2.07: d1f23d_
  • Chain 'E':
    Compound: transmembrane glycoprotein
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q89797 (42-End)
      • engineered (27)
      • insertion (36-41)
    Domains in SCOPe 2.07: d1f23e_
  • Chain 'F':
    Compound: transmembrane glycoprotein
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q89797 (42-75)
      • engineered (27)
      • insertion (39-41)
    Domains in SCOPe 2.07: d1f23f_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1f23A (A:)
    sgivqqqnnllraieaqqhllqltvwgtkqlqarilsggrggwmewdreinnytslihsl
    ieesqnqqekneqell
    

    Sequence, based on observed residues (ATOM records): (download)
    >1f23A (A:)
    sgivqqqnnllraieaqqhllqltvwgtkqlqarlsggrggwmewdreinnytslihsli
    eesqnqqekneqel
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1f23B (B:)
    sgivqqqnnllraieaqqhllqltvwgtkqlqarilsggrggwmewdreinnytslihsl
    ieesqnqqekneqell
    

    Sequence, based on observed residues (ATOM records): (download)
    >1f23B (B:)
    sgivqqqnnllraieaqqhllqltvwgtkqlqarirggwmewdreinnytslihsliees
    qnqqekneqell
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1f23C (C:)
    sgivqqqnnllraieaqqhllqltvwgtkqlqarilsggrggwmewdreinnytslihsl
    ieesqnqqekneqell
    

    Sequence, based on observed residues (ATOM records): (download)
    >1f23C (C:)
    sgivqqqnnllraieaqqhllqltvwgtkqlqarirggwmewdreinnytslihsliees
    qnqqekneqel
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1f23D (D:)
    sgivqqqnnllraieaqqhllqltvwgtkqlqarilsggrggwmewdreinnytslihsl
    ieesqnqqekneqell
    

    Sequence, based on observed residues (ATOM records): (download)
    >1f23D (D:)
    sgivqqqnnllraieaqqhllqltvwgtkqlqarilsggrggwmewdreinnytslihsl
    ieesqnqqekneqel
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1f23E (E:)
    sgivqqqnnllraieaqqhllqltvwgtkqlqarilsggrggwmewdreinnytslihsl
    ieesqnqqekneqell
    

    Sequence, based on observed residues (ATOM records): (download)
    >1f23E (E:)
    sgivqqqnnllraieaqqhllqltvwgtkqlqarilsggrggwmewdreinnytslihsl
    ieesqnqqekneqel
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1f23F (F:)
    sgivqqqnnllraieaqqhllqltvwgtkqlqarilsggrggwmewdreinnytslihsl
    ieesqnqqekneqell
    

    Sequence, based on observed residues (ATOM records): (download)
    >1f23F (F:)
    sgivqqqnnllraieaqqhllqltvwgtkqlqarilrggwmewdreinnytslihsliee
    sqnqqekneqell