PDB entry 1f22

View 1f22 on RCSB PDB site
Description: a proton-nmr investigation of the fully reduced cytochrome c7 from desulfuromonas acetoxidans. comparison between the reduced and the oxidized forms.
Deposited on 2000-05-23, released 2000-06-21
The last revision prior to the SCOP 1.71 freeze date was dated 2000-06-21, with a file datestamp of 2000-06-21.
Experiment type: NMR35
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1f22a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1f22A (A:)
    advvtyenkkgnvtfdhkahaeklgcdachegtpakiaidkksahkdacktchksnngpt
    kcggchik