PDB entry 1f22

View 1f22 on RCSB PDB site
Description: a proton-nmr investigation of the fully reduced cytochrome c7 from desulfuromonas acetoxidans. comparison between the reduced and the oxidized forms.
Class: electron transport
Keywords: triheme, ELECTRON TRANSPORT
Deposited on 2000-05-23, released 2000-06-21
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytochrome c7
    Species: Desulfuromonas acetoxidans [TaxId:891]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1f22a_
  • Heterogens: HEC

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1f22A (A:)
    advvtyenkkgnvtfdhkahaeklgcdachegtpakiaidkksahkdacktchksnngpt
    kcggchik