PDB entry 1f20

View 1f20 on RCSB PDB site
Description: crystal structure of rat neuronal nitric-oxide synthase fad/nadp+ domain at 1.9a resolution.
Class: oxidoreductase
Keywords: Nitric-xoide synthase, reductase domain, FAD, NADP+, OXIDOREDUCTASE
Deposited on 2000-05-22, released 2001-10-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.186
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nitric-oxide synthase
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P29476 (0-434)
      • conflict (45)
    Domains in SCOPe 2.07: d1f20a1, d1f20a2
  • Heterogens: FAD, NAP, GOL, FMT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1f20A (A:)
    swkrnkfrltyvaeapdltqglsnvhkkrvsaarllsrqnlqspkssrstifvrlhtngn
    qelqyqpgdhlgvfpgnhedlvnalierledappanhvvkvemleerntalgvisnwkde
    srlppctifqafkyyldittpptplqlqqfaslatnekekqrllvlskglqeyeewkwgk
    nptmvevleefpsiqmpatllltqlsllqpryysissspdmypdevhltvaivsyhtrdg
    egpvhhgvcsswlnriqaddvvpcfvrgapsfhlprnpqvpcilvgpgtgiapfrsfwqq
    rqfdiqhkgmnpcpmvlvfgcrqskidhiyreetlqaknkgvfrelytaysrepdrpkky
    vqdvlqeqlaesvyralkeqgghiyvcgdvtmaadvlkaiqrimtqqgklseedagvfis
    rlrddnryhedifgv