PDB entry 1f1y

View 1f1y on RCSB PDB site
Description: crystal structure of homoprotocatechuate 2,3-dioxygenase from brevibacterium fuscum (full length protein)
Class: oxidoreductase
Keywords: Dioxygenase, Extradiol, Iron, Biodegradation, Aromatic
Deposited on 2000-05-20, released 2003-06-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2003-07-29, with a file datestamp of 2007-04-25.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.16
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: homoprotocatechuate 2,3-dioxygenase
    Species: BREVIBACTERIUM FUSCUM
    Database cross-references and differences (RAF-indexed):
    • GB AAB66502
    Domains in SCOPe 2.07: d1f1ya1, d1f1ya2
  • Chain 'B':
    Compound: homoprotocatechuate 2,3-dioxygenase
    Species: BREVIBACTERIUM FUSCUM
    Database cross-references and differences (RAF-indexed):
    • GB AAB66502
    Domains in SCOPe 2.07: d1f1yb1, d1f1yb2
  • Heterogens: OF3, DHY, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1f1yA (A:)
    msneipkpvapapdilrcayaelvvtdlaksrnfyvdvlglhvsyedenqiylrsfeefi
    hhnlvltkgpvaalkamafrvrtpedvdkaeayyqelgcrterrkdgfvkgigdalrved
    plgfpyefffetthverlhmrydlysagelvrldhfnqvtpdvprgrkyledlgfrvted
    iqddegttyaawmhrkgtvhdtaltggngprlhhvafsthekhniiqicdkmgalrisdr
    iergpgrhgvsnafylyildpdnhrieiytqdyytgdpdnptitwnvhdnqrrdwwgnpv
    vpswyteaskvldldgnvqeiiertddselevtigadgfsftragdedgsyhgqaskgfk
    lgnql
    

    Sequence, based on observed residues (ATOM records): (download)
    >1f1yA (A:)
    eipkpvapapdilrcayaelvvtdlaksrnfyvdvlglhvsyedenqiylrsfeefihhn
    lvltkgpvaalkamafrvrtpedvdkaeayyqelgcrterrkdgfvkgigdalrvedplg
    fpyefffetthverlhmrydlysagelvrldhfnqvtpdvprgrkyledlgfrvtediqd
    degttyaawmhrkgtvhdtaltggngprlhhvafsthekhniiqicdkmgalrisdrier
    gpgrhgvsnafylyildpdnhrieiytqdyytgdpdnptitwnvhdnqrrdwwgnpvvps
    wyteaskvldldgnvqeiiertddselevtigadgfsftragdedgsyhgqaskgf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1f1yB (B:)
    msneipkpvapapdilrcayaelvvtdlaksrnfyvdvlglhvsyedenqiylrsfeefi
    hhnlvltkgpvaalkamafrvrtpedvdkaeayyqelgcrterrkdgfvkgigdalrved
    plgfpyefffetthverlhmrydlysagelvrldhfnqvtpdvprgrkyledlgfrvted
    iqddegttyaawmhrkgtvhdtaltggngprlhhvafsthekhniiqicdkmgalrisdr
    iergpgrhgvsnafylyildpdnhrieiytqdyytgdpdnptitwnvhdnqrrdwwgnpv
    vpswyteaskvldldgnvqeiiertddselevtigadgfsftragdedgsyhgqaskgfk
    lgnql
    

    Sequence, based on observed residues (ATOM records): (download)
    >1f1yB (B:)
    eipkpvapapdilrcayaelvvtdlaksrnfyvdvlglhvsyedenqiylrsfeefihhn
    lvltkgpvaalkamafrvrtpedvdkaeayyqelgcrterrkdgfvkgigdalrvedplg
    fpyefffetthverlhmrydlysagelvrldhfnqvtpdvprgrkyledlgfrvtediqd
    degttyaawmhrkgtvhdtaltggngprlhhvafsthekhniiqicdkmgalrisdrier
    gpgrhgvsnafylyildpdnhrieiytqdyytgdpdnptitwnvhdnqrrdwwgnpvvps
    wyteaskvldldgnvqeiiertddselevtigadgfsftragdedgsyhgqaskgf