PDB entry 1f1x

View 1f1x on RCSB PDB site
Description: crystal structure of homoprotocatechuate 2,3-dioxygenase from brevibacterium fuscum
Deposited on 2000-05-20, released 2003-06-10
The last revision prior to the SCOP 1.65 freeze date was dated 2003-06-10, with a file datestamp of 2003-06-10.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.168
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1f1xA (A:)
    msneipkpvapapdilrcayaelvvtdlaksrnfyvdvlglhvsyedenqiylrsfeefi
    hhnlvltkgpvaalkamafrvrtpedvdkaeayyqelgcrterrkdgfvkgigdalrved
    plgfpyefffetthverlhmrydlysagelvrldhfnqvtpdvprgrkyledlgfrvted
    iqddegttyaawmhrkgtvhdtaltggngprlhhvafsthekhniiqicdkmgalrisdr
    iergpgrhgvsnafylyildpdnhrieiytqdyytgdpdnptitwnvhdnqrrdwwgnpv
    vpswyteaskvldldgnvqeii
    

    Sequence, based on observed residues (ATOM records): (download)
    >1f1xA (A:)
    eipkpvapapdilrcayaelvvtdlaksrnfyvdvlglhvsyedenqiylrsfeefihhn
    lvltkgpvaalkamafrvrtpedvdkaeayyqelgcrterrkdgfvkgigdalrvedplg
    fpyefffetthverlhmrydlysagelvrldhfnqvtpdvprgrkyledlgfrvtediqd
    degttyaawmhrkgtvhdtaltggngprlhhvafsthekhniiqicdkmgalrisdrier
    gpgrhgvsnafylyildpdnhrieiytqdyytgdpdnptitwnvhdnqrrdwwgnpvvps
    wyteaskvldldgnvqeii
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1f1xB (B:)
    msneipkpvapapdilrcayaelvvtdlaksrnfyvdvlglhvsyedenqiylrsfeefi
    hhnlvltkgpvaalkamafrvrtpedvdkaeayyqelgcrterrkdgfvkgigdalrved
    plgfpyefffetthverlhmrydlysagelvrldhfnqvtpdvprgrkyledlgfrvted
    iqddegttyaawmhrkgtvhdtaltggngprlhhvafsthekhniiqicdkmgalrisdr
    iergpgrhgvsnafylyildpdnhrieiytqdyytgdpdnptitwnvhdnqrrdwwgnpv
    vpswyteaskvldldgnvqeii
    

    Sequence, based on observed residues (ATOM records): (download)
    >1f1xB (B:)
    eipkpvapapdilrcayaelvvtdlaksrnfyvdvlglhvsyedenqiylrsfeefihhn
    lvltkgpvaalkamafrvrtpedvdkaeayyqelgcrterrkdgfvkgigdalrvedplg
    fpyefffetthverlhmrydlysagelvrldhfnqvtpdvprgrkyledlgfrvtediqd
    degttyaawmhrkgtvhdtaltggngprlhhvafsthekhniiqicdkmgalrisdrier
    gpgrhgvsnafylyildpdnhrieiytqdyytgdpdnptitwnvhdnqrrdwwgnpvvps
    wyteaskvldldgnvqeii
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1f1xC (C:)
    msneipkpvapapdilrcayaelvvtdlaksrnfyvdvlglhvsyedenqiylrsfeefi
    hhnlvltkgpvaalkamafrvrtpedvdkaeayyqelgcrterrkdgfvkgigdalrved
    plgfpyefffetthverlhmrydlysagelvrldhfnqvtpdvprgrkyledlgfrvted
    iqddegttyaawmhrkgtvhdtaltggngprlhhvafsthekhniiqicdkmgalrisdr
    iergpgrhgvsnafylyildpdnhrieiytqdyytgdpdnptitwnvhdnqrrdwwgnpv
    vpswyteaskvldldgnvqeii
    

    Sequence, based on observed residues (ATOM records): (download)
    >1f1xC (C:)
    eipkpvapapdilrcayaelvvtdlaksrnfyvdvlglhvsyedenqiylrsfeefihhn
    lvltkgpvaalkamafrvrtpedvdkaeayyqelgcrterrkdgfvkgigdalrvedplg
    fpyefffetthverlhmrydlysagelvrldhfnqvtpdvprgrkyledlgfrvtediqd
    degttyaawmhrkgtvhdtaltggngprlhhvafsthekhniiqicdkmgalrisdrier
    gpgrhgvsnafylyildpdnhrieiytqdyytgdpdnptitwnvhdnqrrdwwgnpvvps
    wyteaskvldldgnvqeii
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1f1xD (D:)
    msneipkpvapapdilrcayaelvvtdlaksrnfyvdvlglhvsyedenqiylrsfeefi
    hhnlvltkgpvaalkamafrvrtpedvdkaeayyqelgcrterrkdgfvkgigdalrved
    plgfpyefffetthverlhmrydlysagelvrldhfnqvtpdvprgrkyledlgfrvted
    iqddegttyaawmhrkgtvhdtaltggngprlhhvafsthekhniiqicdkmgalrisdr
    iergpgrhgvsnafylyildpdnhrieiytqdyytgdpdnptitwnvhdnqrrdwwgnpv
    vpswyteaskvldldgnvqeii
    

    Sequence, based on observed residues (ATOM records): (download)
    >1f1xD (D:)
    eipkpvapapdilrcayaelvvtdlaksrnfyvdvlglhvsyedenqiylrsfeefihhn
    lvltkgpvaalkamafrvrtpedvdkaeayyqelgcrterrkdgfvkgigdalrvedplg
    fpyefffetthverlhmrydlysagelvrldhfnqvtpdvprgrkyledlgfrvtediqd
    degttyaawmhrkgtvhdtaltggngprlhhvafsthekhniiqicdkmgalrisdrier
    gpgrhgvsnafylyildpdnhrieiytqdyytgdpdnptitwnvhdnqrrdwwgnpvvps
    wyteaskvldldgnvqeii