PDB entry 1f1v

View 1f1v on RCSB PDB site
Description: anaerobic substrate complex of homoprotocatechuate 2,3-dioxygenase from arthrobacter globiformis. (complex with 3,4-dihydroxyphenylacetate)
Class: oxidoreductase
Keywords: Dioxygenase, Extradiol, Manganese, Biodegradation, Aromatic, OXIDOREDUCTASE
Deposited on 2000-05-20, released 2003-06-10
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.166
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: homoprotocatechuate 2,3-dioxygenase
    Species: Arthrobacter globiformis [TaxId:1665]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q44048 (Start-322)
      • see remark 999 (232-236)
      • see remark 999 (238-242)
      • see remark 999 (245-248)
    Domains in SCOPe 2.08: d1f1va1, d1f1va2
  • Chain 'B':
    Compound: homoprotocatechuate 2,3-dioxygenase
    Species: Arthrobacter globiformis [TaxId:1665]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q44048 (Start-322)
      • see remark 999 (232-236)
      • see remark 999 (238-242)
      • see remark 999 (245-248)
    Domains in SCOPe 2.08: d1f1vb1, d1f1vb2
  • Heterogens: MN, DHY, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1f1vA (A:)
    mtnfvptpsvpapdivrcaymeivvtdlaksrefyvdvlglhvteedentiylrsleefi
    hhnlvlrqgpiaavaafayrvkspaevdaaeayykelgcrterrkegftkgigdsvrved
    plgfpyeffyetehverltqrydlysagelvrldhfnqvtpdvprgrayledlgfrvsed
    ikdsdgvtyaawmhrkqtvhdtaltggngprmhhvafathekhniiqicdkmgalrisdr
    iergpgrhgvsnafylyildpdghrieiytqdyytgdpdnptitwdvhdnqrrdwwgnpv
    vpswyteaslvldldgnpqpviv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1f1vA (A:)
    fvptpsvpapdivrcaymeivvtdlaksrefyvdvlglhvteedentiylrsleefihhn
    lvlrqgpiaavaafayrvkspaevdaaeayykelgcrterrkegftkgigdsvrvedplg
    fpyeffyetehverltqrydlysagelvrldhfnqvtpdvprgrayledlgfrvsedikd
    sdgvtyaawmhrkqtvhdtaltggngprmhhvafathekhniiqicdkmgalrisdrier
    gpgrhgvsnafylyildpdghrieiytqdyytgdpdnptitwdvhdnqrrdwwgnpvvps
    wyteaslvldldgnpqpviv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1f1vB (B:)
    mtnfvptpsvpapdivrcaymeivvtdlaksrefyvdvlglhvteedentiylrsleefi
    hhnlvlrqgpiaavaafayrvkspaevdaaeayykelgcrterrkegftkgigdsvrved
    plgfpyeffyetehverltqrydlysagelvrldhfnqvtpdvprgrayledlgfrvsed
    ikdsdgvtyaawmhrkqtvhdtaltggngprmhhvafathekhniiqicdkmgalrisdr
    iergpgrhgvsnafylyildpdghrieiytqdyytgdpdnptitwdvhdnqrrdwwgnpv
    vpswyteaslvldldgnpqpviv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1f1vB (B:)
    fvptpsvpapdivrcaymeivvtdlaksrefyvdvlglhvteedentiylrsleefihhn
    lvlrqgpiaavaafayrvkspaevdaaeayykelgcrterrkegftkgigdsvrvedplg
    fpyeffyetehverltqrydlysagelvrldhfnqvtpdvprgrayledlgfrvsedikd
    sdgvtyaawmhrkqtvhdtaltggngprmhhvafathekhniiqicdkmgalrisdrier
    gpgrhgvsnafylyildpdghrieiytqdyytgdpdnptitwdvhdnqrrdwwgnpvvps
    wyteaslvldldgnpqpviv