PDB entry 1f1u

View 1f1u on RCSB PDB site
Description: crystal structure of homoprotocatechuate 2,3-dioxygenase from arthrobacter globiformis (native, low temperature)
Class: oxidoreductase
Keywords: Dioxygenase, Extradiol, Manganese, Biodegradation, Aromatic, OXIDOREDUCTASE
Deposited on 2000-05-19, released 2003-06-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: homoprotocatechuate 2,3-dioxygenase
    Species: Arthrobacter globiformis [TaxId:1665]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q44048 (Start-322)
      • see remark 999 (232-236)
      • see remark 999 (238-242)
      • see remark 999 (245-248)
    Domains in SCOPe 2.07: d1f1ua1, d1f1ua2
  • Chain 'B':
    Compound: homoprotocatechuate 2,3-dioxygenase
    Species: Arthrobacter globiformis [TaxId:1665]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q44048 (Start-322)
      • see remark 999 (232-236)
      • see remark 999 (238-242)
      • see remark 999 (245-248)
    Domains in SCOPe 2.07: d1f1ub1, d1f1ub2
  • Heterogens: MN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1f1uA (A:)
    mtnfvptpsvpapdivrcaymeivvtdlaksrefyvdvlglhvteedentiylrsleefi
    hhnlvlrqgpiaavaafayrvkspaevdaaeayykelgcrterrkegftkgigdsvrved
    plgfpyeffyetehverltqrydlysagelvrldhfnqvtpdvprgrayledlgfrvsed
    ikdsdgvtyaawmhrkqtvhdtaltggngprmhhvafathekhniiqicdkmgalrisdr
    iergpgrhgvsnafylyildpdghrieiytqdyytgdpdnptitwdvhdnqrrdwwgnpv
    vpswyteaslvldldgnpqpviv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1f1uA (A:)
    tnfvptpsvpapdivrcaymeivvtdlaksrefyvdvlglhvteedentiylrsleefih
    hnlvlrqgpiaavaafayrvkspaevdaaeayykelgcrterrkegftkgigdsvrvedp
    lgfpyeffyetehverltqrydlysagelvrldhfnqvtpdvprgrayledlgfrvsedi
    kdsdgvtyaawmhrkqtvhdtaltggngprmhhvafathekhniiqicdkmgalrisdri
    ergpgrhgvsnafylyildpdghrieiytqdyytgdpdnptitwdvhdnqrrdwwgnpvv
    pswyteaslvldldgnpqpviv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1f1uB (B:)
    mtnfvptpsvpapdivrcaymeivvtdlaksrefyvdvlglhvteedentiylrsleefi
    hhnlvlrqgpiaavaafayrvkspaevdaaeayykelgcrterrkegftkgigdsvrved
    plgfpyeffyetehverltqrydlysagelvrldhfnqvtpdvprgrayledlgfrvsed
    ikdsdgvtyaawmhrkqtvhdtaltggngprmhhvafathekhniiqicdkmgalrisdr
    iergpgrhgvsnafylyildpdghrieiytqdyytgdpdnptitwdvhdnqrrdwwgnpv
    vpswyteaslvldldgnpqpviv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1f1uB (B:)
    nfvptpsvpapdivrcaymeivvtdlaksrefyvdvlglhvteedentiylrsleefihh
    nlvlrqgpiaavaafayrvkspaevdaaeayykelgcrterrkegftkgigdsvrvedpl
    gfpyeffyetehverltqrydlysagelvrldhfnqvtpdvprgrayledlgfrvsedik
    dsdgvtyaawmhrkqtvhdtaltggngprmhhvafathekhniiqicdkmgalrisdrie
    rgpgrhgvsnafylyildpdghrieiytqdyytgdpdnptitwdvhdnqrrdwwgnpvvp
    swyteaslvldldgnpqpviv