PDB entry 1f1u

View 1f1u on RCSB PDB site
Description: crystal structure of homoprotocatechuate 2,3-dioxygenase from arthrobacter globiformis (native, low temperature)
Deposited on 2000-05-19, released 2003-06-10
The last revision prior to the SCOP 1.65 freeze date was dated 2003-06-10, with a file datestamp of 2003-06-10.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.162
AEROSPACI score: 0.66 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1f1uA (A:)
    mtnfvptpsvpapdivrcaymeivvtdlaksrefyvdvlglhvteedentiylrsleefi
    hhnlvlrqgpiaavaafayrvkspaevdaaeayykelgcrterrkegftkgigdsvrved
    plgfpyeffyetehverltqrydlysagelvrldhfnqvtpdvprgrayledlgfrvsed
    ikdsdgvtyaawmhrkqtvhdtaltggngprmhhvafathekhniiqicdkmgalrisdr
    iergpgrhgvsnafylyildpdghrieiytqdyytgdpdnptitwdvhdnqrrdwwgnpv
    vpswyteaslvldldgnpqpviv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1f1uA (A:)
    tnfvptpsvpapdivrcaymeivvtdlaksrefyvdvlglhvteedentiylrsleefih
    hnlvlrqgpiaavaafayrvkspaevdaaeayykelgcrterrkegftkgigdsvrvedp
    lgfpyeffyetehverltqrydlysagelvrldhfnqvtpdvprgrayledlgfrvsedi
    kdsdgvtyaawmhrkqtvhdtaltggngprmhhvafathekhniiqicdkmgalrisdri
    ergpgrhgvsnafylyildpdghrieiytqdyytgdpdnptitwdvhdnqrrdwwgnpvv
    pswyteaslvldldgnpqpviv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1f1uB (B:)
    mtnfvptpsvpapdivrcaymeivvtdlaksrefyvdvlglhvteedentiylrsleefi
    hhnlvlrqgpiaavaafayrvkspaevdaaeayykelgcrterrkegftkgigdsvrved
    plgfpyeffyetehverltqrydlysagelvrldhfnqvtpdvprgrayledlgfrvsed
    ikdsdgvtyaawmhrkqtvhdtaltggngprmhhvafathekhniiqicdkmgalrisdr
    iergpgrhgvsnafylyildpdghrieiytqdyytgdpdnptitwdvhdnqrrdwwgnpv
    vpswyteaslvldldgnpqpviv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1f1uB (B:)
    nfvptpsvpapdivrcaymeivvtdlaksrefyvdvlglhvteedentiylrsleefihh
    nlvlrqgpiaavaafayrvkspaevdaaeayykelgcrterrkegftkgigdsvrvedpl
    gfpyeffyetehverltqrydlysagelvrldhfnqvtpdvprgrayledlgfrvsedik
    dsdgvtyaawmhrkqtvhdtaltggngprmhhvafathekhniiqicdkmgalrisdrie
    rgpgrhgvsnafylyildpdghrieiytqdyytgdpdnptitwdvhdnqrrdwwgnpvvp
    swyteaslvldldgnpqpviv