PDB entry 1f1s

View 1f1s on RCSB PDB site
Description: crystal structure of streptococcus agalactiae hyaluronate lyase at 2.1 angstrom resolution.
Class: lyase
Keywords: The structure consists of three distinct structural domains: two beta domains at two terminals and one alpha domain in the middle of the sequence., LYASE
Deposited on 2000-05-19, released 2002-01-16
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.191
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hyaluronate lyase
    Species: STREPTOCOCCUS AGALACTIAE [TaxId:1311]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q53591 (0-813)
      • see remark 999 (75)
      • see remark 999 (77)
      • see remark 999 (109)
      • see remark 999 (117)
      • see remark 999 (412)
      • see remark 999 (517-518)
      • see remark 999 (711)
      • see remark 999 (723)
    Domains in SCOPe 2.04: d1f1sa1, d1f1sa2, d1f1sa3, d1f1sa4
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1f1sA (A:)
    sehpqpvttqieksvntalnknyvfnkadyqytltnpslgkivggilypnatgsttvkis
    dksgkiikevplsvtastednftklldkwndvtignyvydtndsnmqklnqkldetnakn
    ieaikldsnrtflwkdldnlnnsaqltatyrrledlakqitnphstiyknekairtvkes
    lawlhqnfynvnkdiegsanwwdfeigvprsitgtlslmnnyftdaeiktytdpiehfvp
    daeyfrktlvnpfkalggnlvdmgrvkiiegllrkdntiiektshslknlfttatkaegf
    yadgsyidhtnvaytgaygnvlidgltqllpiiqetdykisnqeldmvykwinqsflpli
    vkgelmdmsrgrsisreaasshaaavevlrgflrlanmsneernldlkstiktiitsnkf
    ynvfnnlksysdianmnkllndstvatkplksnlstfnsmdrlayynakkdfgfalslhs
    krtlnyegmndentrgwytgdgmfyiynsdqshysnhfwptvnpykmagttekdakredt
    tkefmskhskdakektgqvtgtsdfvgsvklndhfalaamdftnwdrtltaqkgwvilnd
    kivflgsnikntngignvsttidqrkddsktpyttyvngktidlkqassqqftdtksvfl
    eskepgrnigyiffknstidierkeqtgtwnsinrtskntsivsnpfitisqkhdnkgds
    ygymmvpnidrtsfdklanskevellensskqqviydknsqtwavikhdnqeslinnqfk
    mnkaglylvqkvgndyqnvyyqpqtmtktdqlai