PDB entry 1f1s

View 1f1s on RCSB PDB site
Description:
Deposited on 2000-05-19, released 2002-01-16
The last revision prior to the SCOP 1.59 freeze date was dated 2002-01-16, with a file datestamp of 2002-01-16.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.191
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1f1sA (A:)
    sehpqpvttqieksvntalnknyvfnkadyqytltnpslgkivggilypnatgsttvkis
    dksgkiikevplsvtastednftklldkwndvtignyvydtndsnmqklnqkldetnakn
    ieaikldsnrtflwkdldnlnnsaqltatyrrledlakqitnphstiyknekairtvkes
    lawlhqnfynvnkdiegsanwwdfeigvprsitgtlslmnnyftdaeiktytdpiehfvp
    daeyfrktlvnpfkalggnlvdmgrvkiiegllrkdntiiektshslknlfttatkaegf
    yadgsyidhtnvaytgaygnvlidgltqllpiiqetdykisnqeldmvykwinqsflpli
    vkgelmdmsrgrsisreaasshaaavevlrgflrlanmsneernldlkstiktiitsnkf
    ynvfnnlksysdianmnkllndstvatkplksnlstfnsmdrlayynakkdfgfalslhs
    krtlnyegmndentrgwytgdgmfyiynsdqshysnhfwptvnpykmagttekdakredt
    tkefmskhskdakektgqvtgtsdfvgsvklndhfalaamdftnwdrtltaqkgwvilnd
    kivflgsnikntngignvsttidqrkddsktpyttyvngktidlkqassqqftdtksvfl
    eskepgrnigyiffknstidierkeqtgtwnsinrtskntsivsnpfitisqkhdnkgds
    ygymmvpnidrtsfdklanskevellensskqqviydknsqtwavikhdnqeslinnqfk
    mnkaglylvqkvgndyqnvyyqpqtmtktdqlai