PDB entry 1f1o

View 1f1o on RCSB PDB site
Description: structural studies of adenylosuccinate lyases
Class: lyase
Keywords: purine biosynthesis, LYASE
Deposited on 2000-05-19, released 2001-01-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 3.25 Å
R-factor: 0.336
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: adenylosuccinate lyase
    Species: Bacillus subtilis [TaxId:1423]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1f1oa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1f1oA (A:)
    mierysrpemsaiwtdenrfqawleveilaceawaelgvipkedvkvmrenasfdinril
    eiekdtrhdvvaftravseslgeerkwvhygltstdvvdtalsyllkqandillkdlerf
    vdiikekakehkytvmmgrthgvhaepttfglklalwheemkrnlerfkqakagievgki
    sgavgtyanidpfveqyvceklglkaapistqtlqrdrhadymatlaliatsiekfavei
    rglqksetreveeffakgqkgssamphkrnpigsenmtgmarvirgymmtayenvplwhe
    rdishssaeriilpdatialnymlnrfsnivknltvfpenmkrnmdrtlgliysqrvlla
    lidtgltreeaydtvqpkameawekqvpfrelveaeekitsrlspekiadcfdynyhlkn
    vdliferlgla
    

    Sequence, based on observed residues (ATOM records): (download)
    >1f1oA (A:)
    emsaiwtdenrfqawleveilaceawaelgvipkedvkvmrenasfdinrileiekdtrh
    dvvaftravseslgeerkwvhygltstdvvdtalsyllkqandillkdlerfvdiikeka
    kehkytvmmthgvhaepttfglklalwheemkrnlerfkqakagievgkisgnidpfveq
    yvceklglkaapistqtlqrdrhadymatlaliatsiekfaveirglqksetreveefsa
    mphkrnpigsenmtgmarvirgymmtayenvplwherdishssaeriilpdatialnyml
    nrfsnivknltvfpenmkrnliysqrvllaeekitsrlspekiadcfdyny