PDB entry 1f1m

View 1f1m on RCSB PDB site
Description: crystal structure of outer surface protein c (ospc)
Class: immune system
Keywords: lyme disease, ospc, hb19, helical bundle, dimer, immune system
Deposited on 2000-05-19, released 2001-04-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: outer surface protein c
    Species: Borrelia burgdorferi [TaxId:139]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9AGB1 (Start-163)
      • conflict (44)
      • engineered (59)
    Domains in SCOPe 2.07: d1f1ma_
  • Chain 'B':
    Compound: outer surface protein c
    Species: Borrelia burgdorferi [TaxId:139]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9AGB1 (Start-163)
      • conflict (44)
      • engineered (59)
    Domains in SCOPe 2.07: d1f1mb_
  • Chain 'C':
    Compound: outer surface protein c
    Species: Borrelia burgdorferi [TaxId:139]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9AGB1 (Start-163)
      • conflict (44)
      • engineered (59)
    Domains in SCOPe 2.07: d1f1mc_
  • Chain 'D':
    Compound: outer surface protein c
    Species: Borrelia burgdorferi [TaxId:139]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9AGB1 (Start-163)
      • conflict (44)
      • engineered (59)
    Domains in SCOPe 2.07: d1f1md_
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1f1mA (A:)
    kgpnlteiskkitesnavvlavkevetlltsidelakaigkkiksdvsldneadhngslm
    sgaylistlitkkisaikdsgelkaeiekakkcseeftaklkgehtdlgkegvtddnakk
    ailktnndktkgadeleklfesvknlskaakemltnsvkeltsp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1f1mA (A:)
    pnlteiskkitesnavvlavkevetlltsidelakaigkkiksdvsldneadhngslmsg
    aylistlitkkisaikdsgelkaeiekakkcseeftaklkgehtdlgkegvtddnakkai
    lktnndktkgadeleklfesvknlskaakemltnsvkeltsp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1f1mB (B:)
    kgpnlteiskkitesnavvlavkevetlltsidelakaigkkiksdvsldneadhngslm
    sgaylistlitkkisaikdsgelkaeiekakkcseeftaklkgehtdlgkegvtddnakk
    ailktnndktkgadeleklfesvknlskaakemltnsvkeltsp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1f1mB (B:)
    pnlteiskkitesnavvlavkevetlltsidelakaigkkiksdvsldneadhngslmsg
    aylistlitkkisaikdsgelkaeiekakkcseeftaklkgehtdlgkegvtddnakkai
    lktnndktkgadeleklfesvknlskaakemltnsvkeltsp
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1f1mC (C:)
    kgpnlteiskkitesnavvlavkevetlltsidelakaigkkiksdvsldneadhngslm
    sgaylistlitkkisaikdsgelkaeiekakkcseeftaklkgehtdlgkegvtddnakk
    ailktnndktkgadeleklfesvknlskaakemltnsvkeltsp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1f1mC (C:)
    pnlteiskkitesnavvlavkevetlltsidelakaigkkiksdvsldneadhngslmsg
    aylistlitkkisaikdsgelkaeiekakkcseeftaklkgehtdlgkegvtddnakkai
    lktnndktkgadeleklfesvknlskaakemltnsvkeltsp
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1f1mD (D:)
    kgpnlteiskkitesnavvlavkevetlltsidelakaigkkiksdvsldneadhngslm
    sgaylistlitkkisaikdsgelkaeiekakkcseeftaklkgehtdlgkegvtddnakk
    ailktnndktkgadeleklfesvknlskaakemltnsvkeltsp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1f1mD (D:)
    pnlteiskkitesnavvlavkevetlltsidelakaigkkiksdvsldneadhngslmsg
    aylistlitkkisaikdsgelkaeiekakkcseeftaklkgehtdlgkegvtddnakkai
    lktnndktkgadeleklfesvknlskaakemltnsvkeltsp