PDB entry 1f1j

View 1f1j on RCSB PDB site
Description: crystal structure of caspase-7 in complex with acetyl-asp-glu-val-asp-cho
Class: apoptosis, hydrolase/hydrolase inhibitor
Keywords: caspase-7, cysteine protease, HYDROLASE, APOPTOSIS, HYDROLASE-HYDROLASE INHIBITOR COMPLEX
Deposited on 2000-05-19, released 2001-05-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-07-03, with a file datestamp of 2013-06-28.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: 0.185
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: caspase-7 protease
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P55210 (303-End)
      • conflict (172)
      • cloning artifact (300-301)
      • conflict (302)
    Domains in SCOPe 2.07: d1f1ja_
  • Chain 'B':
    Compound: caspase-7 protease
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P55210
      • conflict (172)
    Domains in SCOPe 2.07: d1f1jb_
  • Chain 'C':
    Compound: ace-asp-glu-val-asp-cho
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1F1J
  • Chain 'D':
    Compound: ace-asp-glu-val-asp-cho
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1F1J (Start-3)
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1f1jA (A:)
    mleaddqgcieeqgvedsanedsvdakpdrssfvpslfskkkknvtmrsikttrdrvpty
    qynmnfeklgkciiinnknfdkvtgmgvrngtdkdaealfkcfrslgfdvivyndcscak
    mqdllkkaseedhtnaacfacillshgeenviygkdgvtpikdltahfrgdrsktllekp
    klffiqacrgtelddgiqadsgpindtdanprykipveadflfaystvpgyyswrspgrg
    swfvqalcsileehgkdleimqiltrvndrvarhfesqsddphfhekkqipcvvsmltke
    lyfsq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1f1jA (A:)
    yqynmnfeklgkciiinnknfdkvtgmgvrngtdkdaealfkcfrslgfdvivyndcsca
    kmqdllkkaseedhtnaacfacillshgeenviygkdgvtpikdltahfrgdrsktllek
    pklffiqacrgtelddgiqkipveadflfaystvpgyyswrspgrgswfvqalcsileeh
    gkdleimqiltrvndrvarhfesqsddphfhekkqipcvvsmltkelyfs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1f1jB (B:)
    mleaddqgcieeqgvedsanedsvdakpdrssfvpslfskkkknvtmrsikttrdrvpty
    qynmnfeklgkciiinnknfdkvtgmgvrngtdkdaealfkcfrslgfdvivyndcscak
    mqdllkkaseedhtnaacfacillshgeenviygkdgvtpikdltahfrgdrsktllekp
    klffiqacrgtelddgiqadsgpindtdanprykipveadflfaystvpgyyswrspgrg
    swfvqalcsileehgkdleimqiltrvndrvarhfesqsddphfhekkqipcvvsmltke
    lyfsq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1f1jB (B:)
    tyqynmnfeklgkciiinnknfdkvtgmgvrngtdkdaealfkcfrslgfdvivyndcsc
    akmqdllkkaseedhtnaacfacillshgeenviygkdgvtpikdltahfrgdrsktlle
    kpklffiqacrgtelddgiqkipveadflfaystvpgyyswrspgrgswfvqalcsilee
    hgkdleimqiltrvndrvarhfesqsddphfhekkqipcvvsmltkelyfs
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.