PDB entry 1f1f

View 1f1f on RCSB PDB site
Description: crystal structure of cytochrome c6 from arthrospira maxima
Deposited on 2000-05-18, released 2001-08-08
The last revision prior to the SCOP 1.59 freeze date was dated 2001-08-08, with a file datestamp of 2001-08-08.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.232
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.59: d1f1fa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1f1fA (A:)
    dvaagasvfsancaachmggrnvivanktlsksdlakylkgfdddavaavayqvtngkna
    mpgfngrlsplqiedvaayvvdqaekgw