PDB entry 1f1e

View 1f1e on RCSB PDB site
Description: crystal structure of the histone from methanopyrus kandleri
Class: DNA binding protein
Keywords: Archaeal Histone Protein, DNA BINDING PROTEIN
Deposited on 2000-05-18, released 2001-10-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 1.37 Å
R-factor: N/A
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: histone fold protein
    Species: Methanopyrus kandleri [TaxId:2320]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O93641 (Start-153)
      • modified residue (37)
      • modified residue (58)
      • modified residue (70)
      • modified residue (147)
    Domains in SCOPe 2.07: d1f1ea_
  • Heterogens: CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1f1eA (A:)
    mavelpkaaierifrqgigerrlsqdakdtiydfvptmaeyvanaaksvldasgkktlme
    ehlkaladvlmvegvedydgelfgratvrrilkragierassdavdlynklicrateelg
    ekaaeyadedgrktvqgedvekaitysmpkggel
    

    Sequence, based on observed residues (ATOM records): (download)
    >1f1eA (A:)
    elpkaaierifrqgigerrlsqdakdtiydfvptmaeyvanaaksvldasgkktlmeehl
    kaladvlmvegvedydgelfgratvrrilkragierassdavdlynklicrateelgeka
    aeyadedgrktvqgedvekaitysmpkggel