PDB entry 1f1c

View 1f1c on RCSB PDB site
Description: crystal structure of cytochrome c549
Class: electron transport
Keywords: dimeric cytochrome, ELECTRON TRANSPORT
Deposited on 2000-05-18, released 2001-08-08
The last revision prior to the SCOPe 2.08 freeze date was dated 2021-03-03, with a file datestamp of 2021-02-26.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytochrome c549
    Species: Arthrospira maxima [TaxId:129910]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1f1ca_
  • Chain 'B':
    Compound: cytochrome c549
    Species: Arthrospira maxima [TaxId:129910]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1f1cb_
  • Heterogens: HEC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1f1cA (A:)
lteelrtfpinaqgdtavlslkeikkgqqvfnaacaqchalgvtrtnpdvnlspealala
tpprdniaalvdyiknpttydgfveiselhpslkssdifpkmrniseddlynvagyillq
pkvrgeqwg

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1f1cB (B:)
lteelrtfpinaqgdtavlslkeikkgqqvfnaacaqchalgvtrtnpdvnlspealala
tpprdniaalvdyiknpttydgfveiselhpslkssdifpkmrniseddlynvagyillq
pkvrgeqwg