PDB entry 1f1b

View 1f1b on RCSB PDB site
Description:
Deposited on 2000-05-18, released 2000-11-22
The last revision prior to the SCOP 1.67 freeze date was dated 2000-11-22, with a file datestamp of 2000-11-22.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.196
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.67: d1f1ba1, d1f1ba2
  • Chain 'B':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.67: d1f1bb1, d1f1bb2
  • Chain 'C':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.67: d1f1bc1, d1f1bc2
  • Chain 'D':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.67: d1f1bd1, d1f1bd2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1f1bA (A:)
    anplyqkhiisindlsrddlnlvlataaklkanpqpellkhkviascffeastrtrlsfe
    tsmhrlgasvvgfsdsantslgkkgetladtisvistyvdaivmrhpqegaarlatefsg
    nvpvlnagdgsnqhptqtlldlftiqetqgrldnlhvamvgdlkygrtvhsltqalakfd
    gnrfyfiapdalampqyildmldekgiawslhssieevmaevdilymtrvqkerldpsey
    anvkaqfvlrasdlhnakanmkvlhplarvdeiatdvdktphawyfqqagngifarqall
    alvlnrdlvl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1f1bB (B:)
    mthdnklqveaikrgtvidhipaqigfkllslfkltetdqritiglnlpsgemgrkdlik
    ientflsedqvdqlalyapqatvnridnyevvgksrpslperidnvlvcpnsncishaep
    vsssfavrkrandialkckycekefshnvvlan
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1f1bC (C:)
    anplyqkhiisindlsrddlnlvlataaklkanpqpellkhkviascffeastrtrlsfe
    tsmhrlgasvvgfsdsantslgkkgetladtisvistyvdaivmrhpqegaarlatefsg
    nvpvlnagdgsnqhptqtlldlftiqetqgrldnlhvamvgdlkygrtvhsltqalakfd
    gnrfyfiapdalampqyildmldekgiawslhssieevmaevdilymtrvqkerldpsey
    anvkaqfvlrasdlhnakanmkvlhplarvdeiatdvdktphawyfqqagngifarqall
    alvlnrdlvl
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1f1bD (D:)
    mthdnklqveaikrgtvidhipaqigfkllslfkltetdqritiglnlpsgemgrkdlik
    ientflsedqvdqlalyapqatvnridnyevvgksrpslperidnvlvcpnsncishaep
    vsssfavrkrandialkckycekefshnvvlan