PDB entry 1f1a

View 1f1a on RCSB PDB site
Description: Crystal structure of yeast H48Q cuznsod fals mutant analog
Class: oxidoreductase
Keywords: FALS, CuZnSOD, Lou Gehrig's Disease, OXIDOREDUCTASE
Deposited on 2000-05-18, released 2002-12-18
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: copper-zinc superoxide dismutase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00445 (Start-153)
      • engineered (48)
    Domains in SCOPe 2.08: d1f1aa_
  • Heterogens: CU, ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1f1aA (A:)
    mvqavavlkgdagvsgvvkfeqasesepttvsyeiagnspnaergfhiqefgdatngcvs
    agphfnpfkkthgaptdevrhvgdmgnvktdengvakgsfkdslikligptsvvgrsvvi
    hagqddlgkgdteeslktgnagprpacgvigltn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1f1aA (A:)
    vqavavlkgdagvsgvvkfeqasesepttvsyeiagnspnaergfhiqefgdatngcvsa
    gphfnpfkkthgaptdevrhvgdmgnvktdengvakgsfkdslikligptsvvgrsvvih
    agqddlgkgdteeslktgnagprpacgvigltn