PDB entry 1f19

View 1f19 on RCSB PDB site
Description: three-dimensional structure of fab r19.9, a monoclonal murine antibody specific for the $p-azobenzenearsonate group
Deposited on 1988-11-29, released 1989-04-19
The last revision was dated 1992-10-15, with a file datestamp of 2007-04-25.
Experiment type: XRAY
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    no info in PDB for this chain
  • Chain 'L':
    no info in PDB for this chain

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records:
    >1f19H (H:)
    qvqlkesgaelvaasssvkmsckasgytftsygvnwvkqrpgqglewigyinpgkgylsy
    nekfkgkttltvdrssstaymqlrsltsedsavyfcarsfyggsdlavyyfdswgqgttl
    tvsakttppsvfplapgcgdttgssvtlgclvkgyfpesvtvtwnsgslsssvhtfpall
    qsglytmsssvtvpsstwpsqtvtcsvahpassttvdkkl
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records:
    >1f19L (L:)
    diqmtqttsslsaslgdrvtiscrasqdisnylnwyqqkpdgtvkllvyytsrlhsgvps
    rfsgsgsgtdysltisnlehediatyfcqqgsttprtfgggtkleikrradaaptvsifp
    pssqqltsggasvvcflnnfypkdinvkwkidgserqngvldsntewdskdstgsmsstl
    tltkdeyerhnsytceathktstspivksfnrnec