PDB entry 1f16

View 1f16 on RCSB PDB site
Description: solution structure of a pro-apoptotic protein bax
Class: apoptosis
Keywords: helical protein, apoptosis
Deposited on 2000-05-18, released 2000-11-22
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (apoptosis regulator bax, membrane isoform alpha)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1f16a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1f16A (A:)
    mdgsgeqprgggptsseqimktgalllqgfiqdragrmggeapelaldpvpqdastkkls
    eclkrigdeldsnmelqrmiaavdtdsprevffrvaadmfsdgnfnwgrvvalfyfaskl
    vlkalctkvpelirtimgwtldflrerllgwiqdqggwdgllsyfgtptwqtvtifvagv
    ltasltiwkkmg