PDB entry 1f15

View 1f15 on RCSB PDB site
Description: cucumber mosaic virus (strain fny)
Class: Virus
Keywords: virus, beta barrel, Icosahedral virus
Deposited on 2000-05-18, released 2000-06-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-07.
Experiment type: XRAY
Resolution: 3.2 Å
R-factor: 0.246
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: coat protein
    Species: Cucumber mosaic virus (strain FNY) [TaxId:12307]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P69466 (Start-217)
      • conflict (106)
    Domains in SCOPe 2.07: d1f15a_
  • Chain 'B':
    Compound: coat protein
    Species: Cucumber mosaic virus (strain FNY) [TaxId:12307]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P69466 (Start-217)
      • conflict (106)
    Domains in SCOPe 2.07: d1f15b_
  • Chain 'C':
    Compound: coat protein
    Species: Cucumber mosaic virus (strain FNY) [TaxId:12307]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P69466 (Start-217)
      • conflict (106)
    Domains in SCOPe 2.07: d1f15c_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1f15A (A:)
    mdksestsagrnrrrrprrgsrsapssadanfrvlsqqlsrlnktlaagrptinhptfvg
    sercrpgytftsitlkppkidrgsyygkrlllpdsvteydkklvsrlqirvnplpkfdst
    vwvtvrkvpassdlsvaaisamfadgaspvlvyqyaasgvqannkllydlsamradigdm
    rkyavlvyskddaletdelvlhvdiehqriptsgvlpv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1f15A (A:)
    ercrpgytftsitlkppkidrgsyygkrlllpdsvteydkklvsrlqirvnplpkfdstv
    wvtvrkvpassdlsvaaisamfadgaspvlvyqyaasgvqannkllydlsamradigdmr
    kyavlvyskddaletdelvlhvdiehqriptsgvlpv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1f15B (B:)
    mdksestsagrnrrrrprrgsrsapssadanfrvlsqqlsrlnktlaagrptinhptfvg
    sercrpgytftsitlkppkidrgsyygkrlllpdsvteydkklvsrlqirvnplpkfdst
    vwvtvrkvpassdlsvaaisamfadgaspvlvyqyaasgvqannkllydlsamradigdm
    rkyavlvyskddaletdelvlhvdiehqriptsgvlpv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1f15B (B:)
    danfrvlsqqlsrlnktlaagrptinhptfvgsercrpgytftsitlkppkidrgsyygk
    rlllpdsvteydkklvsrlqirvnplpkfdstvwvtvrkvpassdlsvaaisamfadgas
    pvlvyqyaasgvqannkllydlsamradigdmrkyavlvyskddaletdelvlhvdiehq
    riptsgvlpv
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1f15C (C:)
    mdksestsagrnrrrrprrgsrsapssadanfrvlsqqlsrlnktlaagrptinhptfvg
    sercrpgytftsitlkppkidrgsyygkrlllpdsvteydkklvsrlqirvnplpkfdst
    vwvtvrkvpassdlsvaaisamfadgaspvlvyqyaasgvqannkllydlsamradigdm
    rkyavlvyskddaletdelvlhvdiehqriptsgvlpv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1f15C (C:)
    adanfrvlsqqlsrlnktlaagrptinhptfvgsercrpgytftsitlkppkidrgsyyg
    krlllpdsvteydkklvsrlqirvnplpkfdstvwvtvrkvpassdlsvaaisamfadga
    spvlvyqyaasgvqannkllydlsamradigdmrkyavlvyskddaletdelvlhvdieh
    qriptsgvlpv