PDB entry 1f14

View 1f14 on RCSB PDB site
Description: l-3-hydroxyacyl-coa dehydrogenase (apo)
Class: oxidoreductase
Keywords: L-3-hydroxyacyl-CoA (apoenzyme)
Deposited on 2000-05-18, released 2000-09-27
The last revision prior to the SCOP 1.75 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.213
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: l-3-hydroxyacyl-coa dehydrogenase
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q16836 (Start-301)
      • engineered (79)
    Domains in SCOP 1.75: d1f14a1, d1f14a2
  • Chain 'B':
    Compound: l-3-hydroxyacyl-coa dehydrogenase
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q16836 (Start-301)
      • engineered (79)
    Domains in SCOP 1.75: d1f14b1, d1f14b2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1f14A (A:)
    sssstasasakkiivkhvtviggglmgagiaqvaaatghtvvlvdqtedilakskkgiee
    slrkvakkkfaenpkagdecvektlstiatstdaasvvhstdlvveaivenlkvknelfk
    rldkfaaehtifasntsslqitsianattrqdrfaglhffnpvpvmklveviktpmtsqk
    tfeslvdfskalgkhpvsckdtpgfivnrllvpylmeairlyergdaskedidtamklga
    gypmgpfelldyvgldttkfivdgwhemdaenplhqpspslnklvaenkfgkktgegfyk
    yklehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1f14A (A:)
    kiivkhvtviggglmgagiaqvaaatghtvvlvdqtedilakskkgieeslrkvakkkfa
    enpkagdecvektlstiatstdaasvvhstdlvveaivenlkvknelfkrldkfaaehti
    fasntsslqitsianattrqdrfaglhffnpvpvmklveviktpmtsqktfeslvdfska
    lgkhpvsckdtpgfivnrllvpylmeairlyergdaskedidtamklgagypmgpfelld
    yvgldttkfivdgwhemdaenplhqpspslnklvaenkfgkktgegfykyk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1f14B (B:)
    sssstasasakkiivkhvtviggglmgagiaqvaaatghtvvlvdqtedilakskkgiee
    slrkvakkkfaenpkagdecvektlstiatstdaasvvhstdlvveaivenlkvknelfk
    rldkfaaehtifasntsslqitsianattrqdrfaglhffnpvpvmklveviktpmtsqk
    tfeslvdfskalgkhpvsckdtpgfivnrllvpylmeairlyergdaskedidtamklga
    gypmgpfelldyvgldttkfivdgwhemdaenplhqpspslnklvaenkfgkktgegfyk
    yklehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1f14B (B:)
    kiivkhvtviggglmgagiaqvaaatghtvvlvdqtedilakskkgieeslrkvakkkfa
    enpkagdecvektlstiatstdaasvvhstdlvveaivenlkvknelfkrldkfaaehti
    fasntsslqitsianattrqdrfaglhffnpvpvmklveviktpmtsqktfeslvdfska
    lgkhpvsckdtpgfivnrllvpylmeairlyergdaskedidtamklgagypmgpfelld
    yvgldttkfivdgwhemdaenplhqpspslnklvaenkfgkktgegfykyk