PDB entry 1f12

View 1f12 on RCSB PDB site
Description: l-3-hydroxyacyl-coa dehydrogenase complexed with 3-hydroxybutyryl-coa
Class: oxidoreductase
Keywords: L-3-hydroxyacyl-CoA complexed with 3-hydroxybutyryl-CoA, OXIDOREDUCTASE
Deposited on 2000-05-18, released 2000-09-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.212
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: l-3-hydroxyacyl-coa dehydrogenase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q16836 (Start-301)
      • engineered (79)
      • expression tag (302-303)
    Domains in SCOPe 2.07: d1f12a1, d1f12a2, d1f12a3
  • Chain 'B':
    Compound: l-3-hydroxyacyl-coa dehydrogenase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q16836 (Start-301)
      • engineered (79)
    Domains in SCOPe 2.07: d1f12b1, d1f12b2
  • Heterogens: 3HC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1f12A (A:)
    sssstasasakkiivkhvtviggglmgagiaqvaaatghtvvlvdqtedilakskkgiee
    slrkvakkkfaenpkagdecvektlstiatstdaasvvhstdlvveaivenlkvknelfk
    rldkfaaehtifasntsslqitsianattrqdrfaglhffnpvpvmklveviktpmtsqk
    tfeslvdfskalgkhpvsckdtpgfivnrllvpylmeairlyergdaskedidtamklga
    gypmgpfelldyvgldttkfivdgwhemdaenplhqpspslnklvaenkfgkktgegfyk
    yklehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1f12A (A:)
    kiivkhvtviggglmgagiaqvaaatghtvvlvdqtedilakskkgieeslrkvakkkfa
    enpkagdecvektlstiatstdaasvvhstdlvveaivenlkvknelfkrldkfaaehti
    fasntsslqitsianattrqdrfaglhffnpvpvmklveviktpmtsqktfeslvdfska
    lgkhpvsckdtpgfivnrllvpylmeairlyergdaskedidtamklgagypmgpfelld
    yvgldttkfivdgwhemdaenplhqpspslnklvaenkfgkktgegfykykle
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1f12B (B:)
    sssstasasakkiivkhvtviggglmgagiaqvaaatghtvvlvdqtedilakskkgiee
    slrkvakkkfaenpkagdecvektlstiatstdaasvvhstdlvveaivenlkvknelfk
    rldkfaaehtifasntsslqitsianattrqdrfaglhffnpvpvmklveviktpmtsqk
    tfeslvdfskalgkhpvsckdtpgfivnrllvpylmeairlyergdaskedidtamklga
    gypmgpfelldyvgldttkfivdgwhemdaenplhqpspslnklvaenkfgkktgegfyk
    yklehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1f12B (B:)
    kiivkhvtviggglmgagiaqvaaatghtvvlvdqtedilakskkgieeslrkvakkkfa
    enpkagdecvektlstiatstdaasvvhstdlvveaivenlkvknelfkrldkfaaehti
    fasntsslqitsianattrqdrfaglhffnpvpvmklveviktpmtsqktfeslvdfska
    lgkhpvsckdtpgfivnrllvpylmeairlyergdaskedidtamklgagypmgpfelld
    yvgldttkfivdgwhemdaenplhqpspslnklvaenkfgkktgegfykyk