PDB entry 1f11

View 1f11 on RCSB PDB site
Description: f124 fab fragment from a monoclonal anti-pres2 antibody
Class: immune system
Keywords: immunoglobulin, antibody, fab, hepatitis B, preS2
Deposited on 2000-05-18, released 2000-08-30
The last revision prior to the SCOP 1.75 freeze date was dated 2001-02-06, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.184
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: f124 immunoglobulin (kappa light chain)
    Species: MUS MUSCULUS
    Database cross-references and differences (RAF-indexed):
    • GB CAA10003 (0-111)
    • GB AAC28909 (112-End)
    Domains in SCOP 1.75: d1f11a1, d1f11a2
  • Chain 'B':
    Compound: f124 immunoglobulin (igg1 heavy chain)
    Species: MUS MUSCULUS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01869 (0-118)
    • GB AAC52820 (119-End)
    Domains in SCOP 1.75: d1f11b1, d1f11b2
  • Chain 'C':
    Compound: f124 immunoglobulin (kappa light chain)
    Species: MUS MUSCULUS
    Database cross-references and differences (RAF-indexed):
    • GB CAA10003 (0-111)
    • GB AAC28909 (112-End)
    Domains in SCOP 1.75: d1f11c1, d1f11c2
  • Chain 'D':
    Compound: f124 immunoglobulin (igg1 heavy chain)
    Species: MUS MUSCULUS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01869 (0-118)
    • GB AAC52820 (119-End)
    Domains in SCOP 1.75: d1f11d1, d1f11d2

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1f11A (A:)
    dmvltqspaslavslgqratisckasqsvdydgdsymnwyqqkpgqppklliyvasnlks
    giparfsgsgsgtdftlnihpveeedaatyycqqsnedpftfgsgtkleikradaaptvs
    ifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysms
    stltltkdeyerhnsytceathktstspivksfnrnec
    

    Sequence, based on observed residues (ATOM records): (download)
    >1f11A (A:)
    dmvltqspaslavslgqratisckasqsvdydgdsymnwyqqkpgqppklliyvasnlks
    giparfsgsgsgtdftlnihpveeedaatyycqqsnedpftfgsgtkleikradaaptvs
    ifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysms
    stltltkdeyerhnsytceathktstspivksfnrn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1f11B (B:)
    evqlqqsgpelvkpgasvkmsckasgytftdyymkwvkqshgkslewigdinpnnggtgy
    nqkfkgkatltvdkssstaymqlnsltsedsavyycandygstygfaywgqgtlvtvsaa
    kttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdl
    ytlsssvtvpssprpsetvtcnvahpasstkvdkkivprdc
    

    Sequence, based on observed residues (ATOM records): (download)
    >1f11B (B:)
    evqlqqsgpelvkpgasvkmsckasgytftdyymkwvkqshgkslewigdinpnnggtgy
    nqkfkgkatltvdkssstaymqlnsltsedsavyycandygstygfaywgqgtlvtvsaa
    kttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdl
    ytlsssvtvpssprpsetvtcnvahpasstkvdkkivp
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1f11C (C:)
    dmvltqspaslavslgqratisckasqsvdydgdsymnwyqqkpgqppklliyvasnlks
    giparfsgsgsgtdftlnihpveeedaatyycqqsnedpftfgsgtkleikradaaptvs
    ifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysms
    stltltkdeyerhnsytceathktstspivksfnrnec
    

    Sequence, based on observed residues (ATOM records): (download)
    >1f11C (C:)
    dmvltqspaslavslgqratisckasqsvdydgdsymnwyqqkpgqppklliyvasnlks
    giparfsgsgsgtdftlnihpveeedaatyycqqsnedpftfgsgtkleikradaaptvs
    ifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysms
    stltltkdeyerhnsytceathktstspivksfnrn
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1f11D (D:)
    evqlqqsgpelvkpgasvkmsckasgytftdyymkwvkqshgkslewigdinpnnggtgy
    nqkfkgkatltvdkssstaymqlnsltsedsavyycandygstygfaywgqgtlvtvsaa
    kttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdl
    ytlsssvtvpssprpsetvtcnvahpasstkvdkkivprdc
    

    Sequence, based on observed residues (ATOM records): (download)
    >1f11D (D:)
    evqlqqsgpelvkpgasvkmsckasgytftdyymkwvkqshgkslewigdinpnnggtgy
    nqkfkgkatltvdkssstaymqlnsltsedsavyycandygstygfaywgqgtlvtvsaa
    kttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdl
    ytlsssvtvpssprpsetvtcnvahpasstkvdkkivp