PDB entry 1f0y

View 1f0y on RCSB PDB site
Description: l-3-hydroxyacyl-coa dehydrogenase complexed with acetoacetyl-coa and nad+
Class: oxidoreductase
Keywords: Abortive ternary complex
Deposited on 2000-05-17, released 2000-09-01
The last revision prior to the SCOP 1.75 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.21
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: l-3-hydroxyacyl-coa dehydrogenase
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1f0ya1, d1f0ya2
  • Chain 'B':
    Compound: l-3-hydroxyacyl-coa dehydrogenase
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1f0yb1, d1f0yb2
  • Heterogens: CAA, NAD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1f0yA (A:)
    sssstasasakkiivkhvtviggglmgagiaqvaaatghtvvlvdqtedilakskkgiee
    slrkvakkkfaenpkagdefvektlstiatstdaasvvhstdlvveaivenlkvknelfk
    rldkfaaehtifasntsslqitsianattrqdrfaglhffnpvpvmklveviktpmtsqk
    tfeslvdfskalgkhpvsckdtpgfivnrllvpylmeairlyergdaskedidtamklga
    gypmgpfelldyvgldttkfivdgwhemdaenplhqpspslnklvaenkfgkktgegfyk
    yk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1f0yA (A:)
    kiivkhvtviggglmgagiaqvaaatghtvvlvdqtedilakskkgieeslrkvakkkfa
    enpkagdefvektlstiatstdaasvvhstdlvveaivenlkvknelfkrldkfaaehti
    fasntsslqitsianattrqdrfaglhffnpvpvmklveviktpmtsqktfeslvdfska
    lgkhpvsckdtpgfivnrllvpylmeairlyergdaskedidtamklgagypmgpfelld
    yvgldttkfivdgwhemdaenplhqpspslnklvaenkfgkktgegfykyk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1f0yB (B:)
    sssstasasakkiivkhvtviggglmgagiaqvaaatghtvvlvdqtedilakskkgiee
    slrkvakkkfaenpkagdefvektlstiatstdaasvvhstdlvveaivenlkvknelfk
    rldkfaaehtifasntsslqitsianattrqdrfaglhffnpvpvmklveviktpmtsqk
    tfeslvdfskalgkhpvsckdtpgfivnrllvpylmeairlyergdaskedidtamklga
    gypmgpfelldyvgldttkfivdgwhemdaenplhqpspslnklvaenkfgkktgegfyk
    yk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1f0yB (B:)
    kiivkhvtviggglmgagiaqvaaatghtvvlvdqtedilakskkgieeslrkvakkkfa
    enpkagdefvektlstiatstdaasvvhstdlvveaivenlkvknelfkrldkfaaehti
    fasntsslqitsianattrqdrfaglhffnpvpvmklveviktpmtsqktfeslvdfska
    lgkhpvsckdtpgfivnrllvpylmeairlyergdaskedidtamklgagypmgpfelld
    yvgldttkfivdgwhemdaenplhqpspslnklvaenkfgkktgegfykyk