PDB entry 1f0x

View 1f0x on RCSB PDB site
Description: crystal structure of d-lactate dehydrogenase, a peripheral membrane respiratory enzyme.
Class: oxidoreductase
Keywords: oxidoreductase
Deposited on 2000-05-17, released 2000-08-23
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: d-lactate dehydrogenase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1f0xa1, d1f0xa2
  • Chain 'B':
    Compound: d-lactate dehydrogenase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1f0xb1, d1f0xb2
  • Heterogens: FAD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1f0xA (A:)
    mssmtttdnkaflnelarlvgsshlltdpaktaryrkgfrsgqgdalavvfpgsllelwr
    vlkacvtadkiilmqaantgltegstpngndydrdvviistlrldklhvlgkgeqvlayp
    gttlyslekalkplgrephsvigsscigasviggicnnsggslvqrgpaytemslfarin
    edgkltlvnhlgidlgetpeqilskldddrikdddvrhdgrhahdydyvhrvrdieadtp
    arynadpdrlfessgcagklavfavrldtfeaeknqqvfyigtnqpevlteirrhilanf
    enlpvageymhrdiydiaekygkdtflmidklgtdkmpfffnlkgrtdamlekvkffrph
    ftdramqkfghlfpshlpprmknwrdkyehhlllkmagdgvgeakswlvdyfkqaegdff
    vctpeegskaflhrfaaagaairyqavhsdevedilaldialrrndtewyehlppeidsq
    lvhklyyghfmcyvfhqdyivkkgvdvhalkeqmlellqqrgaqypaehnvghlykapet
    lqkfyrendptnsmnpgigktskrknwqeve
    

    Sequence, based on observed residues (ATOM records): (download)
    >1f0xA (A:)
    nkaflnelarlvgsshlltdpaktaryrkgfrsgqgdalavvfpgsllelwrvlkacvta
    dkiilmqaantgltegstpngndydrdvviistlrldklhvlgkgeqvlaypgttlysle
    kalkplgrephsvigsscigasviggicnnsggslvqrgpaytemslfarinedgkltlv
    nhlgidlgetpeqilskldddrikdddvrhdgrhahdydyvhrvrdieadtparynadpd
    rlfessgcagklavfavrldtfeaeknqqvfyigtnqpevlteirrhilanfenlpvage
    ymhrdiydiaelpprmknwrdkyehhlllkmagdgvgeakswlvdyfkqaegdffvctpe
    egskaflhrfaaagaairyqavhsdevedilaldialrrndtewyehlppeidsqlvhkl
    yyghfmcyvfhqdyivkkgvdvhalkeqmlellqqrgaqypaehnvghlykapetlqkfy
    rendptnsmnpgigktskrknw
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1f0xB (B:)
    mssmtttdnkaflnelarlvgsshlltdpaktaryrkgfrsgqgdalavvfpgsllelwr
    vlkacvtadkiilmqaantgltegstpngndydrdvviistlrldklhvlgkgeqvlayp
    gttlyslekalkplgrephsvigsscigasviggicnnsggslvqrgpaytemslfarin
    edgkltlvnhlgidlgetpeqilskldddrikdddvrhdgrhahdydyvhrvrdieadtp
    arynadpdrlfessgcagklavfavrldtfeaeknqqvfyigtnqpevlteirrhilanf
    enlpvageymhrdiydiaekygkdtflmidklgtdkmpfffnlkgrtdamlekvkffrph
    ftdramqkfghlfpshlpprmknwrdkyehhlllkmagdgvgeakswlvdyfkqaegdff
    vctpeegskaflhrfaaagaairyqavhsdevedilaldialrrndtewyehlppeidsq
    lvhklyyghfmcyvfhqdyivkkgvdvhalkeqmlellqqrgaqypaehnvghlykapet
    lqkfyrendptnsmnpgigktskrknwqeve
    

    Sequence, based on observed residues (ATOM records): (download)
    >1f0xB (B:)
    nkaflnelarlvgsshlltdpaktaryrkgfrsgqgdalavvfpgsllelwrvlkacvta
    dkiilmqaantgltegstpngndydrdvviistlrldklhvlgkgeqvlaypgttlysle
    kalkplgrephsvigsscigasviggicnnsggslvqrgpaytemslfarinedgkltlv
    nhlgidlgetpeqilskldddrikdddvrhdgrhahdydyvhrvrdieadtparynadpd
    rlfessgcagklavfavrldtfeaeknqqvfyigtnqpevlteirrhilanfenlpvage
    ymhrdiydiaelpprmknwrdkyehhlllkmagdgvgeakswlvdyfkqaegdffvctpe
    egskaflhrfaaagaairyqavhsdevedilaldialrrndtewyehlppeidsqlvhkl
    yyghfmcyvfhqdyivkkgvdvhalkeqmlellqqrgaqypaehnvghlykapetlqkfy
    rendptnsmnpgigktskrknw