PDB entry 1f0v

View 1f0v on RCSB PDB site
Description: Crystal structure of an Rnase A dimer displaying a new type of 3D domain swapping
Deposited on 2000-05-17, released 2001-02-21
The last revision prior to the SCOP 1.55 freeze date was dated 2001-02-21, with a file datestamp of .
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.184
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1f0va_
  • Chain 'B':
    Domains in SCOP 1.55: d1f0vb_
  • Chain 'C':
    Domains in SCOP 1.55: d1f0vc_
  • Chain 'D':
    Domains in SCOP 1.55: d1f0vd_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1f0vA (A:)
    ketaaakferqhmdsstsaasssnycnqmmksrnltkdrckpvntfvhesladvqavcsq
    knvackngqtncyqsystmsitdcretgsskypncaykttqankhiivacegnpyvpvhf
    dasv
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1f0vB (B:)
    ketaaakferqhmdsstsaasssnycnqmmksrnltkdrckpvntfvhesladvqavcsq
    knvackngqtncyqsystmsitdcretgsskypncaykttqankhiivacegnpyvpvhf
    dasv
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1f0vC (C:)
    ketaaakferqhmdsstsaasssnycnqmmksrnltkdrckpvntfvhesladvqavcsq
    knvackngqtncyqsystmsitdcretgsskypncaykttqankhiivacegnpyvpvhf
    dasv
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1f0vD (D:)
    ketaaakferqhmdsstsaasssnycnqmmksrnltkdrckpvntfvhesladvqavcsq
    knvackngqtncyqsystmsitdcretgsskypncaykttqankhiivacegnpyvpvhf
    dasv