PDB entry 1f0p

View 1f0p on RCSB PDB site
Description: mycobacterium tuberculosis antigen 85b with trehalose
Deposited on 2000-05-16, released 2001-01-24
The last revision prior to the SCOP 1.55 freeze date was dated 2001-01-24, with a file datestamp of .
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.195
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1f0pa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1f0pA (A:)
    srpglpveylqvpspsmgrdikvqfqsggnnspavylldglraqddyngwdintpafewy
    yqsglsivmpvggqssfysdwyspacgkagcqtykwetfltselpqwlsanravkptgsa
    aiglsmagssamilaayhpqqfiyagslsalldpsqgmgpsliglamgdaggykaadmwg
    pssdpawerndptqqipklvanntrlwvycgngtpnelgganipaeflenfvrssnlkfq
    daynaagghnavfnfppngthsweywgaqlnamkgdlqsslgag