PDB entry 1f0o

View 1f0o on RCSB PDB site
Description: pvuii endonuclease/cognate DNA complex (glutaraldehyde-crosslinked crystal) at ph 7.5 with two calcium ions at each active site
Class: hydrolase/DNA
Keywords: PROTEIN-DNA COMPLEX, ENDONUCLEASE TYPE II, RESTRICTION ENZYME, Catalytic Metal visualization, hydrolase-DNA COMPLEX
Deposited on 2000-05-16, released 2000-11-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: type II restriction enzyme pvuii
    Species: Proteus vulgaris [TaxId:585]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1f0oa_
  • Chain 'B':
    Compound: type II restriction enzyme pvuii
    Species: Proteus vulgaris [TaxId:585]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1f0ob_
  • Chain 'C':
    Compound: (5'-d(*tp*gp*ap*cp*cp*ap*gp*cp*tp*gp*gp*tp*c-3')
  • Chain 'D':
    Compound: (5'-d(*tp*gp*ap*cp*cp*ap*gp*cp*tp*gp*gp*tp*c-3')
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1f0oA (A:)
    mshpdlnkllelwphiqeyqdlalkhgindifqdnggkllqvllitgltvlpgregndav
    dnagqeyelksinidltkgfsthhhmnpviiakyrqvpwifaiyrgiaieaiyrlepkdl
    efyydkwerkwysdghkdinnpkipvkyvmehgtkiy
    

    Sequence, based on observed residues (ATOM records): (download)
    >1f0oA (A:)
    shpdlnkllelwphiqeyqdlalkhgindifqdnggkllqvllitgltvlpegndavdna
    gqeyelksinidltkgfsthhhmnpviiakyrqvpwifaiyrgiaieaiyrlepkdlefy
    ydkwerkwysdghkdinnpkipvkyvmehgtkiy
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1f0oB (B:)
    mshpdlnkllelwphiqeyqdlalkhgindifqdnggkllqvllitgltvlpgregndav
    dnagqeyelksinidltkgfsthhhmnpviiakyrqvpwifaiyrgiaieaiyrlepkdl
    efyydkwerkwysdghkdinnpkipvkyvmehgtkiy
    

    Sequence, based on observed residues (ATOM records): (download)
    >1f0oB (B:)
    pdlnkllelwphiqeyqdlalkhgindifqdnggkllqvllitgltvlpegndavdnagq
    eyelksinidltkgfsthhhmnpviiakyrqvpwifaiyrgiaieaiyrlepkdlefyyd
    kwerkwysdghkdinnpkipvkyvmehgtkiy
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.