PDB entry 1f0n

View 1f0n on RCSB PDB site
Description: mycobacterium tuberculosis antigen 85b
Class: transferase
Keywords: MYCOLYL TRANSFERASE; 30KDA SECRETORY PROTEIN; ANTIGEN 85B, Structural Genomics, PSI, Protein Structure Initiative, TB Structural Genomics Consortium, TBSGC
Deposited on 2000-05-16, released 2001-01-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.196
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: antigen 85b
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1f0na_
  • Heterogens: MES, MPD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1f0nA (A:)
    fsrpglpveylqvpspsmgrdikvqfqsggnnspavylldglraqddyngwdintpafew
    yyqsglsivmpvggqssfysdwyspacgkagcqtykwetfltselpqwlsanravkptgs
    aaiglsmagssamilaayhpqqfiyagslsalldpsqgmgpsliglamgdaggykaadmw
    gpssdpawerndptqqipklvanntrlwvycgngtpnelgganipaeflenfvrssnlkf
    qdaynaagghnavfnfppngthsweywgaqlnamkgdlqsslgag
    

    Sequence, based on observed residues (ATOM records): (download)
    >1f0nA (A:)
    srpglpveylqvpspsmgrdikvqfqsggnnspavylldglraqddyngwdintpafewy
    yqsglsivmpvggqssfysdwyspacgkagcqtykwetfltselpqwlsanravkptgsa
    aiglsmagssamilaayhpqqfiyagslsalldpsqgmgpsliglamgdaggykaadmwg
    pssdpawerndptqqipklvanntrlwvycgngtpnelgganipaeflenfvrssnlkfq
    daynaagghnavfnfppngthsweywgaqlnamkgdlqsslgag