PDB entry 1f0m

View 1f0m on RCSB PDB site
Description: monomeric structure of the human ephb2 sam (sterile alpha motif) domain
Class: signaling protein
Keywords: SAM domain, SIGNALING PROTEIN
Deposited on 2000-05-16, released 2000-07-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.243
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ephrin type-b receptor 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1f0ma_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1f0mA (A:)
    mektrpdytsfntvdewleaikmgqykesfanagftsfdvvsqmmmedilrvgvtlaghq
    kkilnsiqvmraqmnqiqsvev
    

    Sequence, based on observed residues (ATOM records): (download)
    >1f0mA (A:)
    ytsfntvdewleaikmgqykesfanagftsfdvvsqmmmedilrvgvtlaghqkkilnsi
    qvmraqmnqiq