PDB entry 1f0k

View 1f0k on RCSB PDB site
Description: the 1.9 angstrom crystal structure of e. coli murg
Class: transferase
Keywords: Rossmann fold, TRANSFERASE
Deposited on 2000-05-16, released 2000-07-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.22
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: udp-n-acetylglucosamine-n-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol n-acetylglucosamine transferase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P17443 (Start-355)
      • expression tag (356)
    Domains in SCOPe 2.07: d1f0ka1, d1f0ka2
  • Chain 'B':
    Compound: udp-n-acetylglucosamine-n-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol n-acetylglucosamine transferase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P17443 (Start-355)
      • expression tag (356)
    Domains in SCOPe 2.07: d1f0kb1, d1f0kb2
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1f0kA (A:)
    mmsgqgkrlmvmaggtgghvfpglavahhlmaqgwqvrwlgtadrmeadlvpkhgieidf
    irisglrgkgikaliaaplrifnawrqaraimkaykpdvvlgmggyvsgpgglaawslgi
    pvvlheqngiagltnkwlakiatkvmqafpgafpnaevvgnpvrtdvlalplpqqrlagr
    egpvrvlvvggsqgarilnqtmpqvaaklgdsvtiwhqsgkgsqqsveqayaeagqpqhk
    vtefiddmaaayawadvvvcrsgaltvseiaaaglpalfvpfqhkdrqqywnalplekag
    aakiieqpqlsvdavantlagwsretlltmaeraraasipdatervanevsrvaralehh
    hhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1f0kA (A:)
    krlmvmaggtgghvfpglavahhlmaqgwqvrwlgtadrmeadlvpkhgieidfirisgl
    rgkgikaliaaplrifnawrqaraimkaykpdvvlgmggyvsgpgglaawslgipvvlhe
    qngiagltnkwlakiatkvmqafpgafpnaevvgnpvrtdvlalplpqqrlagregpvrv
    lvvggsqgarilnqtmpqvaaklgdsvtiwhqsgkgsqqsveqayaeagqpqhkvtefid
    dmaaayawadvvvcrsgaltvseiaaaglpalfvpfqhkdrqqywnalplekagaakiie
    qpqlsvdavantlagwsretlltmaeraraasipdatervanevsrvaral
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1f0kB (B:)
    mmsgqgkrlmvmaggtgghvfpglavahhlmaqgwqvrwlgtadrmeadlvpkhgieidf
    irisglrgkgikaliaaplrifnawrqaraimkaykpdvvlgmggyvsgpgglaawslgi
    pvvlheqngiagltnkwlakiatkvmqafpgafpnaevvgnpvrtdvlalplpqqrlagr
    egpvrvlvvggsqgarilnqtmpqvaaklgdsvtiwhqsgkgsqqsveqayaeagqpqhk
    vtefiddmaaayawadvvvcrsgaltvseiaaaglpalfvpfqhkdrqqywnalplekag
    aakiieqpqlsvdavantlagwsretlltmaeraraasipdatervanevsrvaralehh
    hhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1f0kB (B:)
    krlmvmaggtgghvfpglavahhlmaqgwqvrwlgtadrmeadlvpkhgieidfirisgl
    rgkgikaliaaplrifnawrqaraimkaykpdvvlgmggyvsgpgglaawslgipvvlhe
    qngiagltnkwlakiatkvmqafpgafpnaevvgnpvrtdvlalplpqqrlagregpvrv
    lvvggsqgarilnqtmpqvaaklgdsvtiwhqsgkgsqqsveqayaeagqpqhkvtefid
    dmaaayawadvvvcrsgaltvseiaaaglpalfvpfqhkdrqqywnalplekagaakiie
    qpqlsvdavantlagwsretlltmaeraraasipdatervanevsrvaral