PDB entry 1f0i

View 1f0i on RCSB PDB site
Description: the first crystal structure of a phospholipase d
Class: hydrolase
Keywords: Phospholipase D, alpha-beta-alpha-beta-alpha structure, HYDROLASE
Deposited on 2000-05-16, released 2001-05-16
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.13
AEROSPACI score: 0.72 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phospholipase d
    Species: STREPTOMYCES SP. [TaxId:172564]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1f0ia1, d1f0ia2
  • Heterogens: PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1f0iA (A:)
    aatphldaveqtlrqvspglegdvwertsgnkldgsaadpsdwllqtpgcwgddkcadrv
    gtkrllakmtenignatrtvdistlapfpngafqdaivaglkesaakgnslkvrilvgaa
    pvyhmngipskyrdkltaklgkaaenitlnvasmttsktafswnhskilvvdgqsaltgg
    inswkddyldtthpvsdvdlaltgpaagsagryldtlwtwtcknksniasvwfaasgnag
    cmptmhkdtnpkaspatgnvpviavgglgvgikdvdpkstfrpdlptasdtkcvvglhdn
    tnadrdydtvnpeesalralvasakghieisqqdlnatcpplprydirlydalaakmaag
    vkvrivvsdpanrgavgsggysqikslseisdtlrnrlanitggqqaaktamcsnlqlat
    frsspngkwadghpyaqhhklvsvdsstfyigsknlypswlqdfgyivespeaakqldak
    lldpqwkysqetatvdyargicga
    

    Sequence, based on observed residues (ATOM records): (download)
    >1f0iA (A:)
    aatphldaveqtlrqvspglegdvwertsgnkldgsaadpsdwllqtpgcwgddkcadrv
    gtkrllakmtenignatrtvdistlapfpngafqdaivaglkesaakgnslkvrilvgaa
    phmngipskyrdkltaklgkaaenitlnvasmttsktafswnhskilvvdgqsaltggin
    swkddyldtthpvsdvdlaltgpaagsagryldtlwtwtcknksniasvwfaasgnagcm
    ptmhkdtnpkaspatgnvpviavgglgvgikdvdpkstfrpdlptasdtkcvvglhdntn
    adrdydtvnpeesalralvasakghieisqqdlnatcpplprydirlydalaakmaagvk
    vrivvsdpanrgysqikslseisdtlrnrlanitggqqaaktamcsnlqlatfrsspngk
    wadghpyaqhhklvsvdsstfyigsknlypswlqdfgyivespeaakqldaklldpqwky
    sqetatvdyargicga