PDB entry 1f0b

View 1f0b on RCSB PDB site
Description: crystal structure of the green fluorescent protein (gfp) variant yfp-h148q
Class: luminescent protein
Keywords: beta barrel, luminescence, bioluminescence, photoactive protein, green fluorescent protein, LUMINESCENT PROTEIN
Deposited on 2000-05-15, released 2000-11-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-05-05, with a file datestamp of 2009-05-01.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.188
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Green fluorescent protein
    Species: Aequorea victoria [TaxId:6100]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P42212
      • chromophore (65)
      • engineered (67)
      • engineered (71)
      • engineered (79)
      • engineered (147)
      • engineered (202)
    Domains in SCOPe 2.07: d1f0ba_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1f0bA (A:)
    mskgeelftgvvpilveldgdvnghkfsvsgegegdatygkltlkficttgklpvpwptl
    vttfgyglqcfarypdhmkrhdffksampegyvqertiffkddgnyktraevkfegdtlv
    nrielkgidfkedgnilghkleynynsqnvyimadkqkngikvnfkirhniedgsvqlad
    hyqqntpigdgpvllpdnhylsyqsalskdpnekrdhmvllefvtaagithgmdelyk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1f0bA (A:)
    kgeelftgvvpilveldgdvnghkfsvsgegegdatygkltlkficttgklpvpwptlvt
    tfgyglqcfarypdhmkrhdffksampegyvqertiffkddgnyktraevkfegdtlvnr
    ielkgidfkedgnilghkleynynsqnvyimadkqkngikvnfkirhniedgsvqladhy
    qqntpigdgpvllpdnhylsyqsalskdpnekrdhmvllefvtaagit