PDB entry 1f0a

View 1f0a on RCSB PDB site
Description: solution structure of dini
Class: protein binding
Keywords: bicelle, DinI, dipolar coupling, liquid crystal, NMR, Pf1, RecA
Deposited on 2000-05-15, released 2000-06-21
The last revision prior to the SCOPe 2.08 freeze date was dated 2001-01-10, with a file datestamp of 2007-04-25.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.09 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: DNA-damage-inducible protein I
  Species: Escherichia coli
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q47143 (0-80)
  Domains in SCOPe 2.08: d1f0aa_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1f0aA (A:)
  mrievtiaktsplpagaidalagelsrriqyafpdneghvsvryaaannlsvigatkedk
  qriseilqetwesaddwfvse