PDB entry 1f09

View 1f09 on RCSB PDB site
Description: crystal structure of the green fluorescent protein (gfp) variant yfp-h148q with two bound iodides
Class: Luminescent Protein
Keywords: beta barrel, LUMINESCENCE, BIOLUMINESCENCE, PHOTOACTIVE PROTEIN, GREEN FLUORESCENT PROTEIN, Luminescent Protein
Deposited on 2000-05-15, released 2000-11-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-05-05, with a file datestamp of 2009-05-01.
Experiment type: XRAY
Resolution: 2.14 Å
R-factor: 0.204
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Green fluorescent protein
    Species: Aequorea victoria [TaxId:6100]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P42212
      • chromophore (65)
      • engineered (67)
      • engineered (71)
      • engineered (79)
      • engineered (147)
      • engineered (202)
    Domains in SCOPe 2.07: d1f09a_
  • Heterogens: IOD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1f09A (A:)
    mskgeelftgvvpilveldgdvnghkfsvsgegegdatygkltlkficttgklpvpwptl
    vttfgyglqcfarypdhmkrhdffksampegyvqertiffkddgnyktraevkfegdtlv
    nrielkgidfkedgnilghkleynynsqnvyimadkqkngikvnfkirhniedgsvqlad
    hyqqntpigdgpvllpdnhylsyqsalskdpnekrdhmvllefvtaagithgmdelyk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1f09A (A:)
    skgeelftgvvpilveldgdvnghkfsvsgegegdatygkltlkficttgklpvpwptlv
    ttfgyglqcfarypdhmkrhdffksampegyvqertiffkddgnyktraevkfegdtlvn
    rielkgidfkedgnilghkleynynsqnvyimadkqkngikvnfkirhniedgsvqladh
    yqqntpigdgpvllpdnhylsyqsalskdpnekrdhmvllefvtaagi