PDB entry 1f08

View 1f08 on RCSB PDB site
Description: crystal structure of the DNA-binding domain of the replication initiation protein e1 from papillomavirus
Class: replication
Keywords: Papillomavirus, DNA-binding domain, replication, initiator protein, helicase
Deposited on 2000-05-15, released 2001-05-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: replication protein e1
    Species: Bovine papillomavirus [TaxId:10571]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03116 (3-147)
      • cloning artifact (0-2)
      • see remark 999 (97)
      • see remark 999 (110)
    Domains in SCOPe 2.07: d1f08a1, d1f08a2
  • Chain 'B':
    Compound: replication protein e1
    Species: Bovine papillomavirus [TaxId:10571]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03116 (3-147)
      • see remark 999 (97)
      • see remark 999 (110)
    Domains in SCOPe 2.07: d1f08b_
  • Heterogens: BR, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1f08A (A:)
    gsratvfklglfkslflcsfhditrlfkndkttnqqwvlavfglaevffeasfellkkqc
    sflqmqkrsheggtcavylicfntaksretvrnlmanmlnvreeclmlqppkirglsaal
    fwfksslspatlkhgalpewiraqttln
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1f08B (B:)
    gsratvfklglfkslflcsfhditrlfkndkttnqqwvlavfglaevffeasfellkkqc
    sflqmqkrsheggtcavylicfntaksretvrnlmanmlnvreeclmlqppkirglsaal
    fwfksslspatlkhgalpewiraqttln
    

    Sequence, based on observed residues (ATOM records): (download)
    >1f08B (B:)
    atvfklglfkslflcsfhditrlfkndkttnqqwvlavfglaevffeasfellkkqcsfl
    qmqkrsheggtcavylicfntaksretvrnlmanmlnvreeclmlqppkirglsaalfwf
    ksslspatlkhgalpewiraqttln