PDB entry 1f07

View 1f07 on RCSB PDB site
Description: structure of coenzyme f420 dependent tetrahydromethanopterin reductase from methanobacterium thermoautotrophicum
Class: oxidoreductase
Keywords: (beta, alpha)8 barrel, TIM barrel, OXIDOREDUCTASE
Deposited on 2000-05-15, released 2000-09-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.208
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: coenzyme f420-dependent n5,n10-methylenetetrahydromethanopterin reductase
    Species: Methanothermobacter thermautotrophicus [TaxId:145262]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1f07a_
  • Chain 'B':
    Compound: coenzyme f420-dependent n5,n10-methylenetetrahydromethanopterin reductase
    Species: Methanothermobacter thermautotrophicus [TaxId:145262]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1f07b_
  • Chain 'C':
    Compound: coenzyme f420-dependent n5,n10-methylenetetrahydromethanopterin reductase
    Species: Methanothermobacter thermautotrophicus [TaxId:145262]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1f07c_
  • Chain 'D':
    Compound: coenzyme f420-dependent n5,n10-methylenetetrahydromethanopterin reductase
    Species: Methanothermobacter thermautotrophicus [TaxId:145262]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1f07d_
  • Heterogens: CL, MPO, MPD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1f07A (A:)
    mkfgiefvpnepiekivklvklaedvgfeyawitdhynnknvyetlaliaegtetiklgp
    gvtnpyvrspaitasaiatldelsngratlgigpgdkatfdalgiewvkpvstirdaiam
    mrtllagektesgaqlmgvkavqekipiymgaqgpmmlktageisdgalinasnpkdfea
    avplikegaeaagksiadidvaaytccsidedaaaaanaakivvafiaagspppvferhg
    lpadtgkkfgellgkgdfggaigavddalmeafsvvgtpdefipkiealgemgvtqyvag
    spigpdkeksikllgeviasf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1f07B (B:)
    mkfgiefvpnepiekivklvklaedvgfeyawitdhynnknvyetlaliaegtetiklgp
    gvtnpyvrspaitasaiatldelsngratlgigpgdkatfdalgiewvkpvstirdaiam
    mrtllagektesgaqlmgvkavqekipiymgaqgpmmlktageisdgalinasnpkdfea
    avplikegaeaagksiadidvaaytccsidedaaaaanaakivvafiaagspppvferhg
    lpadtgkkfgellgkgdfggaigavddalmeafsvvgtpdefipkiealgemgvtqyvag
    spigpdkeksikllgeviasf
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1f07C (C:)
    mkfgiefvpnepiekivklvklaedvgfeyawitdhynnknvyetlaliaegtetiklgp
    gvtnpyvrspaitasaiatldelsngratlgigpgdkatfdalgiewvkpvstirdaiam
    mrtllagektesgaqlmgvkavqekipiymgaqgpmmlktageisdgalinasnpkdfea
    avplikegaeaagksiadidvaaytccsidedaaaaanaakivvafiaagspppvferhg
    lpadtgkkfgellgkgdfggaigavddalmeafsvvgtpdefipkiealgemgvtqyvag
    spigpdkeksikllgeviasf
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1f07D (D:)
    mkfgiefvpnepiekivklvklaedvgfeyawitdhynnknvyetlaliaegtetiklgp
    gvtnpyvrspaitasaiatldelsngratlgigpgdkatfdalgiewvkpvstirdaiam
    mrtllagektesgaqlmgvkavqekipiymgaqgpmmlktageisdgalinasnpkdfea
    avplikegaeaagksiadidvaaytccsidedaaaaanaakivvafiaagspppvferhg
    lpadtgkkfgellgkgdfggaigavddalmeafsvvgtpdefipkiealgemgvtqyvag
    spigpdkeksikllgeviasf