PDB entry 1f04

View 1f04 on RCSB PDB site
Description: solution structure of oxidized bovine microsomal cytochrome b5 mutant (e44a, e48a, e56a, d60a) and its interaction with cytochrome c
Deposited on 2000-05-14, released 2000-06-21
The last revision prior to the SCOP 1.55 freeze date was dated 2000-06-21, with a file datestamp of 2000-06-21.
Experiment type: NMR35
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.09 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.55: d1f04a_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1f04A (A:)
  avkyytleeiqkhnnskstwlilhykvydltkfleehpggeavlraqaggdatanfeavg
  hstdarelsktfiigelhpddr