PDB entry 1f02

View 1f02 on RCSB PDB site
Description: crystal structure of c-terminal 282-residue fragment of intimin in complex with translocated intimin receptor (tir) intimin-binding domain
Class: cell adhesion
Keywords: Immunoglobulin-like fold, C-type lectin-like fold, four-helix bundle, CELL ADHESION
Deposited on 2000-05-14, released 2000-07-12
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.247
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'I':
    Compound: intimin
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1f02i1, d1f02i2, d1f02i3
  • Chain 'T':
    Compound: translocated intimin receptor
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9KWH9 (1-65)
      • cloning artifact (0)
    Domains in SCOPe 2.08: d1f02t1, d1f02t2

PDB Chain Sequences:

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1f02I (I:)
    asiteikadkttavangqdaitytvkvmkgdkpvsnqevtftttlgklsnstektdtngy
    akvtltsttpgkslvsarvsdvavdvkapeveffttltiddgnieivgtgvkgklptvwl
    qygqvnlkasggngkytwrsanpaiasvdassgqvtlkekgtttisvissdnqtatytia
    tpnslivpnmskrvtyndavntcknfggklpssqnelenvfkawgaankyeyykssqtii
    swvqqtaqdaksgvastydlvkqnplnnikasesnayatcvk
    

  • Chain 'T':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1f02T (T:)
    mdqaanaaesatkdqltqeafknpenqkvnidangnaipsgelkddiveqiaqqakeage
    varqqa