PDB entry 1ezz

View 1ezz on RCSB PDB site
Description: crystal structure of e. coli aspartate transcarbamoylase p268a mutant in the t-state
Deposited on 2000-05-12, released 2000-11-22
The last revision prior to the SCOP 1.69 freeze date was dated 2000-11-22, with a file datestamp of 2000-11-22.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.182
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ezzA (A:)
    anplyqkhiisindlsrddlnlvlataaklkanpqpellkhkviascffeastrtrlsfe
    tsmhrlgasvvgfsdsantslgkkgetladtisvistyvdaivmrhpqegaarlatefsg
    nvpvlnagdgsnqhptqtlldlftiqetqgrldnlhvamvgdlkygrtvhsltqalakfd
    gnrfyfiapdalampqyildmldekgiawslhssieevmaevdilymtrvqkerldpsey
    anvkaqfvlrasdlhnakanmkvlhplarvdeiatdvdktphawyfqqagngifarqall
    alvlnrdlvl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ezzB (B:)
    mthdnklqveaikrgtvidhipaqigfkllslfkltetdqritiglnlpsgemgrkdlik
    ientflsedqvdqlalyapqatvnridnyevvgksrpslperidnvlvcpnsncishaep
    vsssfavrkrandialkckycekefshnvvlan
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ezzC (C:)
    anplyqkhiisindlsrddlnlvlataaklkanpqpellkhkviascffeastrtrlsfe
    tsmhrlgasvvgfsdsantslgkkgetladtisvistyvdaivmrhpqegaarlatefsg
    nvpvlnagdgsnqhptqtlldlftiqetqgrldnlhvamvgdlkygrtvhsltqalakfd
    gnrfyfiapdalampqyildmldekgiawslhssieevmaevdilymtrvqkerldpsey
    anvkaqfvlrasdlhnakanmkvlhplarvdeiatdvdktphawyfqqagngifarqall
    alvlnrdlvl
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ezzD (D:)
    mthdnklqveaikrgtvidhipaqigfkllslfkltetdqritiglnlpsgemgrkdlik
    ientflsedqvdqlalyapqatvnridnyevvgksrpslperidnvlvcpnsncishaep
    vsssfavrkrandialkckycekefshnvvlan