PDB entry 1ezy

View 1ezy on RCSB PDB site
Description: high-resolution solution structure of free rgs4 by nmr
Deposited on 2000-05-12, released 2001-01-15
The last revision prior to the SCOP 1.65 freeze date was dated 2001-01-15, with a file datestamp of 2001-01-15.
Experiment type: NMR30
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.65: d1ezya_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ezyA (A:)
    mrgsvsqeevkkwaeslenlinhecglaafkaflkseyseenidfwisceeykkikspsk
    lspkakkiynefisvqatkevnldsctreetsrnmleptitcfdeaqkkifnlmekdsyr
    rflksrfyldltnpsscgaekqkgakssadctslvpqcahhhhhhp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ezyA (A:)
    vsqeevkkwaeslenlinhecglaafkaflkseyseenidfwisceeykkikspsklspk
    akkiynefisvqatkevnldsctreetsrnmleptitcfdeaqkkifnlmekdsyrrflk
    srfyldltn