PDB entry 1ezy

View 1ezy on RCSB PDB site
Description: high-resolution solution structure of free rgs4 by nmr
Class: signaling protein inhibitor
Keywords: 4-helix bundle, free RGS4 NMR Structure, SIGNALING PROTEIN INHIBITOR
Deposited on 2000-05-12, released 2001-01-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.07 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: regulator of g-protein signaling 4
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ezya_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ezyA (A:)
    mrgsvsqeevkkwaeslenlinhecglaafkaflkseyseenidfwisceeykkikspsk
    lspkakkiynefisvqatkevnldsctreetsrnmleptitcfdeaqkkifnlmekdsyr
    rflksrfyldltnpsscgaekqkgakssadctslvpqcahhhhhhp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ezyA (A:)
    vsqeevkkwaeslenlinhecglaafkaflkseyseenidfwisceeykkikspsklspk
    akkiynefisvqatkevnldsctreetsrnmleptitcfdeaqkkifnlmekdsyrrflk
    srfyldltn