PDB entry 1ezx

View 1ezx on RCSB PDB site
Description: crystal structure of a serpin:protease complex
Class: hydrolase/hydrolase inhibitor
Keywords: protease-inhibitor complex, serpin, alpha-1-antitrypsin, trypsin, HYDROLASE/HYDROLASE INHIBITOR COMPLEX
Deposited on 2000-05-12, released 2000-10-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.205
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: alpha-1-antitrypsin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ezx.1
  • Chain 'B':
    Compound: alpha-1-antitrypsin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ezx.1
  • Chain 'C':
    Compound: Trypsin
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ezxc_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ezxA (A:)
    nkitpnlaefafslyrqlahqsnstniffspvsiatafamlslgtkadthdeileglnfn
    lteipeaqihegfqellrtlnqpdsqlqlttgnglflseglklvdkfledvkklyhseaf
    tvnfgdteeakkqindyvekgtqgkivdlvkeldrdtvfalvnyiffkgkwerpfevkdt
    eeedfhvdqvttvkvpmmkrlgmfniqhckklsswvllmkylgnataifflpdegklqhl
    enelthdiitkflenedrrsaslhlpklsitgtydlksvlgqlgitkvfsngadlsgvte
    eaplklskavhkavltidekgteaagamfleaipm
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ezxB (B:)
    sippevkfnkpfvflmieqntksplfmgkvvnptqk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1ezxC (C:)
    fiflallgaavafpvddddkivggytcgantvpyqvslnsgyhfcggslinsqwvvsaah
    cyksgiqvrlgedninvvegneqfisasksivhpsynsntlnndimliklksaaslnsrv
    asislptscasagtqclisgwgntkssgtsypdvlkclkapilsdsscksaypgqitsnm
    fcagyleggkdscqgdsggpvvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqti
    asn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ezxC (C:)
    cggslinsqwvvsaahcyksasksivhpsynsntlnndimliklkislptscasagtqcl
    iclkapilsdsscksaypgqitsnmfcagylcqgdsggpvvcsgklqgivswgsgcaqkp
    gvytkvcnyvswikqtiasn