PDB entry 1ezw

View 1ezw on RCSB PDB site
Description: structure of coenzyme f420 dependent tetrahydromethanopterin reductase from methanopyrus kandleri
Class: oxidoreductase
Keywords: (beta, alpha)8 barrel, TIM barrel, OXIDOREDUCTASE
Deposited on 2000-05-12, released 2000-09-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-11-16, with a file datestamp of 2011-11-11.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.198
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: coenzyme f420-dependent n5,n10-methylenetetrahydromethanopterin reductase
    Species: Methanopyrus kandleri [TaxId:2320]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8TXY4
      • conflict (343)
    Domains in SCOPe 2.07: d1ezwa_
  • Heterogens: MG, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ezwA (A:)
    maevsfgiellpddkptkiahlikvaedngfeyawicdhynnysymgvltlaavitskik
    lgpgitnpytrhplitasniatldwisggraiigmgpgdkatfdkmglpfpckipiwnpe
    aedevgpatairevkeviyqyleggpveyegkyvktgtadvkarsiqgsdipfymgaqgp
    imlktageiangvlvnasnpkdfevavpkieegakeagrsldeidvaaytcfsidkdedk
    aieatkivvafivmgspdvvlerhgidtekaeqiaeaigkgdfgtaiglvdedmieafsi
    agdpdtvvdkieellkagvtqvvvgspigpdkekaielvgqeviphfke
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ezwA (A:)
    aevsfgiellpddkptkiahlikvaedngfeyawicdhynnysymgvltlaavitskikl
    gpgitnpytrhplitasniatldwisggraiigmgpgdkatfdkmglpfpckipiwnpea
    edevgpatairevkeviyqyleggpveyegkyvktgtadvkarsiqgsdipfymgaqgpi
    mlktageiangvlvnasnpkdfevavpkieegakeagrsldeidvaaytcfsidkdedka
    ieatkivvafivmgspdvvlerhgidtekaeqiaeaigkgdfgtaiglvdedmieafsia
    gdpdtvvdkieellkagvtqvvvgspigpdkekaielvgqeviphfk