PDB entry 1ezv

View 1ezv on RCSB PDB site
Description: structure of the yeast cytochrome bc1 complex co-crystallized with an antibody fv-fragment
Class: oxidoreductase/electron transport
Keywords: cytochrome bc1 complex, complex III, QCR, mitochondria, yeast, antibody Fv-fragment, stigmatellin, coenzyme Q6, matrix processing peptidases, ubiquinone, electron transfer, proton transfer, Q-cycle, OXIDOREDUCTASE/ELECTRON TRANSPORT COMPLEX
Deposited on 2000-05-12, released 2001-05-16
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.222
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ubiquinol-cytochrome c reductase complex core protein I
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07256 (0-429)
      • conflict (125)
    Domains in SCOPe 2.05: d1ezva1, d1ezva2
  • Chain 'B':
    Compound: ubiquinol-cytochrome c reductase complex core protein 2
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • GB AAB64620 (0-351)
    Domains in SCOPe 2.05: d1ezvb1, d1ezvb2
  • Chain 'C':
    Compound: cytochrome b
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • GB CAA58861 (0-384)
    Domains in SCOPe 2.05: d1ezvc2, d1ezvc3
  • Chain 'D':
    Compound: cytochrome c1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • GB CAA99258 (0-244)
    Domains in SCOPe 2.05: d1ezvd1, d1ezvd2
  • Chain 'E':
    Compound: ubiquinol-cytochrome c reductase iron-sulfur subunit
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • GB AAB64501 (0-184)
    Domains in SCOPe 2.05: d1ezve1, d1ezve2
  • Chain 'F':
    Compound: ubiquinol-cytochrome c reductase complex 14 kd protein
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • GB AAB64968 (0-124)
    Domains in SCOPe 2.05: d1ezvf_
  • Chain 'G':
    Compound: ubiquinol-cytochrome c reductase complex ubiquinone-binding protein qp-c
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • GB CAA89461 (0-92)
    Domains in SCOPe 2.05: d1ezvg_
  • Chain 'H':
    Compound: ubiquinol-cytochrome c reductase complex 17 kd protein
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • GB BAA09272 (0-73)
    Domains in SCOPe 2.05: d1ezvh_
  • Chain 'I':
    Compound: ubiquinol-cytochrome c reductase complex 7.3 kd protein
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1ezvi_
  • Chain 'X':
    Compound: heavy chain (vh) of fv-fragment
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 1EZV (0-126)
    Domains in SCOPe 2.05: d1ezvx_
  • Chain 'Y':
    Compound: light chain (vl) of fv-fragment
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 1EZV (0-106)
    Domains in SCOPe 2.05: d1ezvy_
  • Heterogens: HEM, FES, SMA, UQ6, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ezvA (A:)
    aevtqlsngivvatehnpahtasvgvvfgsgaanenpynngvsnlwkniflskensavaa
    keglalssnisrdfqsyivsslpgstdksldflnqsfiqqkanllsssnfeatkksvlkq
    vqdfedndhpnrvlehlhstafqntplslptrgtleslenlvvadlesfannhflnsnav
    vvgtgnikhedlvnsiesknlslqtgtkpvlkkkaaflgsevrlrddtlpkawislaveg
    epvnspnyfvaklaaqifgsynafepasrlqgiklldniqeyqlcdnfnhfslsykdsgl
    wgfstatrnvtmiddlihftlkqwnrltisvtdteveraksllklqlgqlyesgnpvnda
    nllgaevlikgsklslgeafkkidaitvkdvkawagkrlwdqdiaiagtgqieglldymr
    irsdmsmmrw
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ezvB (B:)
    ltvsardaptkistlavkvhggsryatkdgvahllnrfnfqntntrsalklvresellgg
    tfkstldreyitlkatflkddlpyyvnaladvlyktafkpheltesvlpaarydyavaeq
    cpvksaedqlyaitfrkglgnpllydgvervslqdikdfadkvytkenlevsgenvvead
    lkrfvdesllstlpagkslvsksepkfflgeenrvrfigdsvaaigipvnkaslaqyevl
    anyltsalselsglissakldkftdgglftlfvrdqdsavvssnikkivadlkkgkdlsp
    ainytklknavqnesvsspielnfdavkdfklgkfnyvavgdvsnlpyldel
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ezvC (C:)
    mafrksnvylslvnsyiidspqpssinywwnmgsllglclviqivtgifmamhyssniel
    afssvehimrdvhngyilrylhangasfffmvmfmhmakglyygsyrsprvtlwnvgvii
    ftltiataflgyccvygqmshwgatvitnlfsaipfvgndivswlwggfsvsnptiqrff
    alhylvpfiiaamvimhlmalhihgssnplgitgnldripmhsyfifkdlvtvflfmlil
    alfvfyspntlghpdnyipgnplvtpasivpewyllpfyailrsipdkllgvitmfaail
    vllvlpftdrsvvrgntfkvlskffffifvfnfvllgqigachvevpyvlmgqiatfiyf
    ayfliivpvistienvlfyigrvnk
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ezvD (D:)
    mtaaehglhapayawshngpfetfdhasirrgyqvyrevcaachsldrvawrtlvgvsht
    neevrnmaeefeyddepdeqgnpkkrpgklsdyipgpypneqaaraanqgalppdlsliv
    karhggcdyifslltgypdeppagvalppgsnynpyfpggsiamarvlfddmveyedgtp
    attsqmakdvttflnwcaepehderkrlglktviilsslyllsiwvkkfkwagiktrkfv
    fnppk
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ezvE (E:)
    kstyrtpnfddvlkenndadkgrsyayfmvgamgllssagakstvetfissmtatadvla
    makvevnlaaiplgknvvvkwqgkpvfirhrtpheiqeansvdmsalkdpqtdadrvkdp
    qwlimlgicthlgcvpigeagdfggwfcpchgshydisgrirkgpaplnleipayefdgd
    kvivg
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ezvF (F:)
    qsftsiarigdyilkspvlsklcvpvanqfinlagykklglkfddliaeenpimqtalrr
    lpedesyarayriirahqtelthhllprnewikaqedvpyllpyileaeaaakekdeldn
    ievsk
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ezvG (G:)
    gppsgktymgwwghmggpkqkgitsyavspyaqkplqgifhnavfnsfrrfksqflyvli
    pagiywywwkngneyneflyskagreelervnv
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ezvH (H:)
    vtdqledlrehfknteegkalvhhyeecaervkiqqqqpgyadlehkedcveeffhlqhy
    ldtataprlfdklk
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ezvI (I:)
    sslyktffkrnavfvgtifagafvfqtvfdtaitswyenhnkgklwkdvkariaa
    

  • Chain 'X':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ezvX (X:)
    evklqesgaglvqpsqslsltcsvtgysitsgyywnwirlfpgnklewvgyisnvgdnny
    npslkdrlsitrdtsknqfflklnsvttedtatyycarseyysvtgyamdywgqgttvtv
    ssawrhp
    

  • Chain 'Y':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ezvY (Y:)
    dieltqtpvslaaslgdrvtiscrasqdinnflnwyqqkpdgtiklliyytsrlhagvps
    rfsgsgsgtdysltisnlepediatyfcqhhikfpwtfgagtkleik