PDB entry 1ezs

View 1ezs on RCSB PDB site
Description: crystal structure of ecotin mutant m84r, w67a, g68a, y69a, d70a bound to rat anionic trypsin II
Class: hydrolase/inhibitor
Keywords: protein-protein interactions, macromolecular complex, protease inhibitor, HYDROLASE/INHIBITOR COMPLEX
Deposited on 2000-05-11, released 2000-06-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.188
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ecotin
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P23827
      • engineered (69)
      • engineered (83)
    Domains in SCOPe 2.07: d1ezsa_
  • Chain 'B':
    Compound: ecotin
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P23827 (Start-141)
      • engineered (69)
      • engineered (83)
    Domains in SCOPe 2.07: d1ezsb_
  • Chain 'C':
    Compound: trypsin II, anionic
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00763
      • see remark 999 (60)
      • engineered (83)
    Domains in SCOPe 2.07: d1ezsc_
  • Chain 'D':
    Compound: trypsin II, anionic
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00763 (0-222)
      • see remark 999 (60)
      • engineered (83)
    Domains in SCOPe 2.07: d1ezsd_
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ezsA (A:)
    aesvqplekiapypqaekgmkrqviqltpqedestlkvelligqtlevdcnlhrlggkle
    nktlegaaaayyvfdkvsspvstrmacpdgkkekkfvtaylgdagmlrynsklpivvytp
    dnvdvkyrvwkaeekidnavvr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ezsA (A:)
    pypqaekgmkrqviqltpqedestlkvelligqtlevdcnlhrlggklenktayyvfdkv
    sspvstrmacpdgkkekkfvtaylgdagmlrynsklpivvytpdnvdvkyrvwkaeekid
    navvr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ezsB (B:)
    aesvqplekiapypqaekgmkrqviqltpqedestlkvelligqtlevdcnlhrlggkle
    nktlegaaaayyvfdkvsspvstrmacpdgkkekkfvtaylgdagmlrynsklpivvytp
    dnvdvkyrvwkaeekidnavvr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ezsB (B:)
    pypqaekgmkrqviqltpqedestlkvelligqtlevdcnlhrlggklenktayyvfdkv
    sspvstrmacpdgkkekkfvtaylgdagmlrynsklpivvytpdnvdvkyrvwkaeekid
    navvr
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ezsC (C:)
    ivggytcqensvpyqvslnsgyhfcggslindqwvvsaahcyksriqvrlgehninvleg
    deqfvnaakiikhpnfdrktlnnnimliklsspvklnarvatvalpsscapagtqclisg
    wgntlssgvnepdllqcldapllpqadceasypgkitdnmvcvgfleggkdscqgdsggp
    vvcngelqgivswgygcalpdnpgvytkvcnyvdwiqdtiaan
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ezsD (D:)
    ivggytcqensvpyqvslnsgyhfcggslindqwvvsaahcyksriqvrlgehninvleg
    deqfvnaakiikhpnfdrktlnnnimliklsspvklnarvatvalpsscapagtqclisg
    wgntlssgvnepdllqcldapllpqadceasypgkitdnmvcvgfleggkdscqgdsggp
    vvcngelqgivswgygcalpdnpgvytkvcnyvdwiqdtiaan