PDB entry 1ezr

View 1ezr on RCSB PDB site
Description: crystal structure of nucleoside hydrolase from leishmania major
Class: hydrolase
Keywords: alpha/beta fold, HYDROLASE
Deposited on 2000-05-11, released 2000-05-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: nucleoside hydrolase
    Species: Leishmania major [TaxId:5664]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ezra_
  • Chain 'B':
    Compound: nucleoside hydrolase
    Species: Leishmania major [TaxId:5664]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ezrb_
  • Chain 'C':
    Compound: nucleoside hydrolase
    Species: Leishmania major [TaxId:5664]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ezrc_
  • Chain 'D':
    Compound: nucleoside hydrolase
    Species: Leishmania major [TaxId:5664]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ezrd_
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ezrA (A:)
    mprkiildcdpgiddavaiflahgnpeiellaittvvgnqslekvtqnarlvadvagivg
    vpvaagctkplvrgvrnashihgetgmgnvsyppefktkldgrhavqliidlimshepkt
    itlvptggltniamavrleprivdrvkevvlmgggyhtgnaspvaefnvfidpeaahivf
    neswnvtmvgldlthlalatpavqkrvrevgtkpaafmlqildfytkvyekehdtygkvh
    dpcavayvidptvmttervpvdielngalttgmtvadfryprpkncrtqvavkldfdkfw
    clvidalerigdpq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ezrA (A:)
    prkiildcdpgiddavaiflahgnpeiellaittvvgnqslekvtqnarlvadvagivgv
    pvaagctkplvrgvrnashihgetgmgnvsyppefktkldgrhavqliidlimshepkti
    tlvptggltniamavrleprivdrvkevvlmgggyhtgnaspvaefnvfidpeaahivfn
    eswnvtmvgldlthlalatpavqkrvrevgtkpaafmlqildfytkvyekehdtygkvhd
    pcavayvidptvmttervpvdielngalttgmtvadfryprpkncrtqvavkldfdkfwc
    lvidalerigdp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ezrB (B:)
    mprkiildcdpgiddavaiflahgnpeiellaittvvgnqslekvtqnarlvadvagivg
    vpvaagctkplvrgvrnashihgetgmgnvsyppefktkldgrhavqliidlimshepkt
    itlvptggltniamavrleprivdrvkevvlmgggyhtgnaspvaefnvfidpeaahivf
    neswnvtmvgldlthlalatpavqkrvrevgtkpaafmlqildfytkvyekehdtygkvh
    dpcavayvidptvmttervpvdielngalttgmtvadfryprpkncrtqvavkldfdkfw
    clvidalerigdpq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ezrB (B:)
    prkiildcdpgiddavaiflahgnpeiellaittvvgnqslekvtqnarlvadvagivgv
    pvaagctkplvrgvrnashihgetgmgnvsyppefktkldgrhavqliidlimshepkti
    tlvptggltniamavrleprivdrvkevvlmgggyhtgnaspvaefnvfidpeaahivfn
    eswnvtmvgldlthlalatpavqkrvrevgtkpaafmlqildfytkvyekehdtygkvhd
    pcavayvidptvmttervpvdielngalttgmtvadfryprpkncrtqvavkldfdkfwc
    lvidalerigdp
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1ezrC (C:)
    mprkiildcdpgiddavaiflahgnpeiellaittvvgnqslekvtqnarlvadvagivg
    vpvaagctkplvrgvrnashihgetgmgnvsyppefktkldgrhavqliidlimshepkt
    itlvptggltniamavrleprivdrvkevvlmgggyhtgnaspvaefnvfidpeaahivf
    neswnvtmvgldlthlalatpavqkrvrevgtkpaafmlqildfytkvyekehdtygkvh
    dpcavayvidptvmttervpvdielngalttgmtvadfryprpkncrtqvavkldfdkfw
    clvidalerigdpq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ezrC (C:)
    prkiildcdpgiddavaiflahgnpeiellaittvvgnqslekvtqnarlvadvagivgv
    pvaagctkplvrgvrnashihgetgmgnvsyppefktkldgrhavqliidlimshepkti
    tlvptggltniamavrleprivdrvkevvlmgggyhtgnaspvaefnvfidpeaahivfn
    eswnvtmvgldlthlalatpavqkrvrevgtkpaafmlqildfytkvyekehdtygkvhd
    pcavayvidptvmttervpvdielngalttgmtvadfryprpkncrtqvavkldfdkfwc
    lvidalerigdp
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1ezrD (D:)
    mprkiildcdpgiddavaiflahgnpeiellaittvvgnqslekvtqnarlvadvagivg
    vpvaagctkplvrgvrnashihgetgmgnvsyppefktkldgrhavqliidlimshepkt
    itlvptggltniamavrleprivdrvkevvlmgggyhtgnaspvaefnvfidpeaahivf
    neswnvtmvgldlthlalatpavqkrvrevgtkpaafmlqildfytkvyekehdtygkvh
    dpcavayvidptvmttervpvdielngalttgmtvadfryprpkncrtqvavkldfdkfw
    clvidalerigdpq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ezrD (D:)
    prkiildcdpgiddavaiflahgnpeiellaittvvgnqslekvtqnarlvadvagivgv
    pvaagctkplvrgvrnashihgetgmgnvsyppefktkldgrhavqliidlimshepkti
    tlvptggltniamavrleprivdrvkevvlmgggyhtgnaspvaefnvfidpeaahivfn
    eswnvtmvgldlthlalatpavqkrvrevgtkpaafmlqildfytkvyekehdtygkvhd
    pcavayvidptvmttervpvdielngalttgmtvadfryprpkncrtqvavkldfdkfwc
    lvidalerigdp