PDB entry 1ezm

View 1ezm on RCSB PDB site
Description: three-dimensional structure of the elastase of pseudomonas aeruginosa at 1.5 angstroms resolution
Class: hydrolase
Keywords: hydrolase
Deposited on 1992-01-13, released 1993-10-31
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-08-25, with a file datestamp of 2009-08-21.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.176
AEROSPACI score: 0.63 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pseudomonas elastase
    Species: Pseudomonas aeruginosa [TaxId:287]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1ezma_
  • Heterogens: ZN, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ezmA (A:)
    aeaggpggnqkigkytygsdygplivndrcemddgnvitvdmnsstddskttpfrfacpt
    ntykqvngaysplndahffggvvfklyrdwfgtsplthklymkvhygrsvenaywdgtam
    lfgdgatmfyplvsldvaahevshgfteqnsgliyrgqsggmneafsdmageaaefymrg
    kndfligydikkgsgalrymdqpsrdgrsidnasqyyngidvhhssgvynrafyllansp
    gwdtrkafevfvdanryywtatsnynsgacgvirsaqnrnysaadvtrafstvgvtcpsa
    l
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ezmA (A:)
    aeaggpggnqkigkytygsdygplivndrcemddgnvitvdmnsstddskttpfrfacpt
    ntykqvngaysplndahffggvvfklyrdwfgtsplthklymkvhygrsvenaywdgtam
    lfgdgatmfyplvsldvaahevshgfteqnsgliyrgqsggmneafsdmageaaefymrg
    kndfligydikkgsgalrymdqpsrdgrsidnasqyyngidvhhssgvynrafyllansp
    gwdtrkafevfvdanryywtatsnynsgacgvirsaqnrnysaadvtrafstvgvtcp